Recombinant Human cytomegalovirus Uncharacterized protein UL78 (UL78)

Code: CSB-CF323720HWV
Size:
20μg
20μg100μg
US$5720
Quantity:
Express system: in vitro E.coli expression system
Species: Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
UL78
Uniprot NO.
Alternative Names
UL78; Uncharacterized protein UL78
Species
Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)
Source
in vitro E.coli expression system
Expression Region
1-431
Target Protein Sequence
MSPSVEETTSVTESIMFAIVSFKHMGPFEGYSMSADRAASDLLIGMFGSVSLVNLLTIIG CLWVLRVTRPPVSVMIFTWNLVLSQFFSILATMLSKGIMLRGALNLSLCRLVLFVDDVGL YSTALFFLFLILDRLSAISYGRDLWHHETRENAGVALYAVAFAWVLSIVAAVPTAATGSL DYRWLGCQIPIQYAAVDLTIKMWFLLGAPMIAVLANVVELAYSDRRDHVWSYVGRVCTFY VTCLMLFVPYYCFRVLRGVLQPASAAGTGFGIMDYVELATRTLLTMRLGILPLFIIAFFS REPTKDLDDSFDYLVERCQQSCHGHFVRRLVQALKRAMYSVELAVCYFSTSVRDVAEAVK KSSSRCYADATSAAVVVTTTTSEKATLVEHAEGMASEMCPGTTIDVSAESSSVLCTDGEN TVASDATVTAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Gene References into Functions
  1. Most importantly, infection experiments with a recombinant human cytomegalovirus carrying tagged versions of pUS27 and pUL78 simultaneously, revealed that these two proteins do not colocalize during viral infection. PMID:24517969
  2. UL78 supports infection at a point after binding but before entry in epithelial cells, a cell type important for in vivo viral replication and spread. PMID:22915800
  3. UL78 forms oligomers and traffics between the plasma membrane and different intracellular compartments. PMID:22327422

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Database Links

KEGG: vg:3077549

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products