Home
Product
Protein
Transmembrane Proteins
Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50)

Recombinant Human cytomegalovirus Nuclear egress membrane protein (UL50)

Code: CSB-CF321475HWV

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5465

Quantity:

Express system: in vitro E.coli expression system

Species: Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

NEC2

Uniprot NO.

P16791

Alternative Names

NEC2; UL50; Nuclear egress protein 2

Species

Human cytomegalovirus (strain AD169) (HHV-5) (HCMV)

Source

in vitro E.coli expression system

Expression Region

1-397

Target Protein Sequence

MEMNKVLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCDAMLKTDTVYCVEYLLS YWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSPARHVGEFNVLKVNESLIVTLKDIE EIKPSAYGVLTKCVVRKSNSASVFNIELIAFGPENEGEYENLLRELYAKKAASTSLAVRN HVTVSSHSGSGPSLWRARMSAALTRTAGKRSSRTASPPPPPRHPSCSPTMVAAGGAAAGP RPPPPPMAAGSWRLCRCEACMGRCGCASEGDADEEEEELLALAGEGKAAAAAAGQDVGGS ARRPLEEHVSRRRGVSTHHRHPPSPPCAPSLERTGYRWAPSSWWRARSGPSRPQSGPWLP ARFATLGPLVLALLLVLALLWRGHGQSSSPTRSAHRD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays an essential role in virion nuclear egress, the first step of virion release from infected cell. Within the host nucleus, NEC1 interacts with the newly formed capsid through the vertexes and directs it to the inner nuclear membrane by associating with NEC2. Induces the budding of the capsid at the inner nuclear membrane as well as its envelopment into the perinuclear space. There, the NEC1/NEC2 complex promotes the fusion of the enveloped capsid with the outer nuclear membrane and the subsequent release of the viral capsid into the cytoplasm where it will reach the secondary budding sites in the host Golgi or trans-Golgi network.

Subcellular Location

Host nucleus inner membrane; Single-pass membrane protein.

Protein Families

Herpesviridae NEC2 protein family

Promotions