MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIALMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Involved in renal water reabsorption.
Gene References into Functions
Being a rapid diagnostic tool for congenital nephrogenic diabetes insipidus , direct sequencing of AVPR2 should be encouraged in newborns with familial predisposition to congenital nephrogenic diabetes insipidus.PMID:29594432
A novel 22.1-kb deletion in AVPR2 was identified, leading to X-linked nephrogenic diabetes insipidus in a Chinese pedigree.PMID:29394883
Here we provide an updated overview of the genetic defects causing NDI, the most recent strategies under investigation for rescuing the activity of mutated AVPR2 or AQP2, or for bypassing defective AVPR2 signaling and restoring AQP2 plasma membrane expression.PMID:29125546
Data found Mutations of Vasopressin Receptor 2 Including Novel L312S Have Differential Effects on TraffickingPMID:27355191
An overview of AVPR2 mutations in genetic forms of nephrogenic diabetes insipidus (review)PMID:27156763
this case report describes a case of congenital nephrogenic diabetes insipidus with an AVPR2 gene I324M missense mutation; this is the first report of this mutation in patients with congenital nephrogenic diabetes insipidusPMID:27565746
the canceling of the desensitization effect of OPC51803 by the pharmacochaperone effect after long-term treatment may produce sustainable signaling, and thus pharmacochaperone agonists such as OPC51803 may serve as promising therapeutics for NDI caused by misfolded V2R mutants.PMID:27601473
AVPR2 missense mutation is associated with nephrogenic diabetes insipidus.PMID:26974133
Data suggest that the congenital congenital nephrogenic diabetes insipidus (NDI) in the patient, his mother and grandmother was probably due to mutation of the arginine vasopressin receptor 2 (AVPR2) gene.PMID:27577218
a splice site mutation in AVPR2 leads to partial X-linked NDI in two brothers.PMID:26795631
A heterozygous deletion in exon 1 of the AVPR2 gene is associated with nephrogenic diabetes insipidus.PMID:26244674
In this study, we identified and characterized a new gain-of function mutation of the V2R, which leads to nephrogenic syndrome of inappropriate diuresis.PMID:26131744
We present a novel mutation in codon 137 within AVPR2 with substitution of glycine for arginine in male dizygotic twins.PMID:27117808
Rescue of the N321K-V2R function by Val(4)-desmopressin action in nephrogenic diabetes insipidus.PMID:24628417
X-linked nephrogenic diabetes insipidus and severity of illness in this family is caused by a novel deletion in the AVPR2 genePMID:24026507
AVP acting at V2R does not appear to regulate water losses from body fluids other than renal excretion during exercise.PMID:24944242
This review summarizes some of the unexpected roles of V2R signaling and suggests that vasopressin signaling itself may contribute crucially to loss of polarity and enhanced proliferation in cystic kidney epithelium.PMID:24556353
52 disease-causing mutations of AVPR2 were identified. missense mutations were most common (54%), followed by deletion mutations. 64 women who had monoallelic disease-causing AVPR2 mutations, 16 had NDI symptoms, including 4 complete NDI subjectsPMID:23150186
Three vasopressin receptor 2 variants: an apparent polymorphism (V266A) and two loss-of-function mutations (R181C and M311V) may be related to nephrogenic syndrome of inappropriate antidiuresis and to nephrogenic diabetes insipidus.PMID:23762448
vasopressin receptor type 2 signaling is controlled by retromer and arrestin in a noncanonical regulatory pathwayPMID:23935101
The V88M mutation is associated with phenotypical diversity, which may be explained by the fact that both the expression level and the hormone-binding affinity are affected by the mutation.PMID:19816050
No pathological variants affecting R137 were detected among the 5,142 AVPR2 alleles successfully genotyped. Even at the population extremes of serum sodium distribution, we estimate minor allele frequencyPMID:23362144
crystal structure of beta-arrestin-1 (also called arrestin-2) in complex with a fully phosphorylated 29-amino-acid carboxy-terminal peptide derived from the human V2 vasopressin receptor (V2Rpp)PMID:23604254
Investigations into primary inherited nephrogenic diabetes insipidus (NDI) have contributed enormously to our understanding of the mechanisms of urinary concentration and identified the vasopressin receptor AVPR2, as well as the water channel aquaporin-2.PMID:23364801
Of the 15 patients with diabetes insipidus eight patients have AVPR2 mutationsPMID:22644838
X-linked nephrogenic diabetes insipidus (NDI) and intellectual disability in two dizygotic twin brothers was caused by a novel contiguous deletion of 17,905 bp of the entire AVPR2 gene and intron 7 of the ARHGAP4 gene.PMID:22965914
The deletion mechanisms in the AVPR2 region do not follow the rules of non-allelic homologous recombination. Review.PMID:22879391
In this mini-review the retrospective analysis of 13 known AVPR2 mutations that have been previously shown in vitro to partially abolish AVPR2 function is described, along with a novel mutation diagnosed in a kindred with partial nephrogenic diabetes insipidus. [Review]PMID:22386940
Loss-of-function mutations in the vasopressin type 2 receptor gene is associated with nephrogenic diabetes insipidus.PMID:21917732
the minor haplotype constructs of AVPR2 SNPs were associated with larger body weight losses during the Ironman Triathlons.PMID:22052024
V2R antagonists can act as protean agonists, serving as pharmacological chaperones for inactivating V2R mutants and also as inverse agonists of wild-type receptors.PMID:22144672
It is suggested that disorder of V2R signaling in the endolymphatic sac for any reason could be involved in the pathogenesis of endolymphatic hydrops.PMID:21574774
A novel missense mutation c.506T > C (p.L169P) in AVPR2 in a patient with inherited nephrogenic diabetes insipidus.PMID:22145481
Overexpression of a V2R fragment corresponding to V2R-i3 as a fusion protein with thioredoxin A at the N-terminus and a hexahistidine tag between the two proteins.PMID:21575724
Our study shows for the first time that renal cancer may effectively synthesize and express the V2-R.PMID:19217806
no asp-lys-ile and asp-arg-tyr mutations significantly altered cAMP production and cell surface expression of V2R in these cellsPMID:20683494
The 12E-V2R variant has increased binding affinity for AVP, resulting in increased signal transduction, and is associated with increased levels of VWF propeptide, VWF, and FVIII.PMID:20403097
study of two unrelated Thai boys with congenital nephrogenic diabetes insipidus; the novel AVPR2 mutation M311V retains partial activity and results in a milder form of nephrogenic diabetes insipidusPMID:20389105
The X-linked nephrogenic diabetes insipidus is caused by a novel mutation in the AVPR2 gene that is predicted to truncate the receptor protein.PMID:19703807
Amino acid substitution of AVPR2 induces the nephrogenic syndrome of inappropriate antidiuresis by reducing surface receptor levels and increasgin cycl AMP production.PMID:20159941
Absence of AVPR2 copy number variation in eunatremic and dysnatremic subjects in non-Hispanic Caucasian populationsPMID:19996159
proteolytic cleavage of the V2 receptor requires a defined conformation and might play a role in signal termination at elevated hormone concentrationsPMID:10561596
A novel type of contiguous gene deletion of AVPR2 has been identified in unrelated Japanese kindreds with nephrogenic diabetes insipidus.PMID:11754100
A new mutation associated with nephrogenic diabetes insipidus was isolated: a 6-AA deletion between G107 and C112.PMID:11868598
Mutations causing NDI include R106C, F287L, and R337X.PMID:11916004
a single amino acid difference in the first extracellular loop determines the efficiency of cell surface expressionPMID:11923476
HV2R has a serine/threonine motif that is required for retention in the cytoplasmPMID:12482593
palmitoylation enhances the recruitment of beta-arrestin to the activated V2 vasopressin receptor thus facilitating processes requiring the scaffolding action of beta-arrestinPMID:12900404
V2 vasopressin receptor degradation is regulated by agonist-promoted ubiquitinationPMID:12960162
examination of interaction with beta-arrestin and trafficking patterns by heterodimerization with V1 vasopressin receptorPMID:14757828