MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged If you have specified tag type, please tell us and we will check if it's possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, may recognize and internalize the complex formed by AVP/Arg-vasopressin, SARS-CoV-2 spike protein and secreted ACE2 through DNM2/dynamin 2-dependent endocytosis.
Gene References into Functions
Patients were different from those previously studied. We measured the expression of the pituitary-specific hormone genes and type 1 corticotrophin-releasing hormone and arginine vasopressin 1b receptors, by quantitative real-time polymerase chain reaction using TaqMan probes.PMID:29979686
Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders.PMID:23962971
The results suggest that the AVPR1B gene rs28373064 is linked to emotional empathy and prosociality.PMID:26354157
AA genotype of rs28418396 single-nucleotide polymorphism near the arginine vasopressin receptor 1b gene is associated with serious adverse events in patients with septic shock treated with vasopressin and norepinephrine.PMID:24919159
Genetic variance of arginine vasopressin receptor 1B(AVPR1B) contributes to overweight and data indicate a link between AVPR1B variance and diabetes mellitus developmentPMID:26503846
The association of AVPR1B G*A-haplotype (rs28632197 and rs33911258, respectively) and decreased Self-transcendence (TCI-125) was demonstrated in the total sample and in Udmurts.PMID:25438555
Participants carrying both GG/GA variant of AVPR1b rs28373064 and AA variant of clock rs6832769 showed highest scores on the Emotional prosocial tendency measure. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality.PMID:25309987
The associations of the AVP 1B receptor may be specific to reactive, emotional rather than proactive or callous types of aggression.PMID:24842238
association between polymorphisms of AVPR1b gene and psychotic dimension.possible involvement of the AVPR1b gene in the etiology of psychotic features in the course of affective disordersPMID:24012103
AVPR1B genetic variation has a role in suicide attempt etiology characterized by elevated depression levels.PMID:23422793
The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for AVPR1b genes and melancholic depression.PMID:23068076
This is the first report of a genetic association between vasopressin receptor 1B and child aggression.PMID:22910476
polymorphism rs28536160 genotype TT of the AVPR1b gene may increase susceptibility for obtaining psychotic features in the course of bipolar disorder I.PMID:22341483
the presence of V1b receptors also found in human Langerhans islets could suggest hormonal control of AVP in human pancreas.PMID:12736162
Data supports a protective effect of this major haplotype for recurrent major depression.PMID:15094789
determination of a C-terminal motif required for export to plasma membranePMID:15528211
V1bR and CRHR1 can form constitutive homo- and heterodimers.PMID:17318384
study found evidence to implicate the AVPR1B gene in the etiology of mood disorders, particularly in femalesPMID:17909131
polymorphisms in the AVPR1B and the CRHR1 genes alter the susceptibility to panic disorderPMID:18384079
AVPR1B is associated with autistic traits, empathy, and Asperger syndrome.PMID:19598235
An association analysis with AVPR1b single-nucleotide polymorphism for attention deficit hyperactivity disorder, was performed in a patient/control sample.PMID:19668115