Recombinant Human Vasopressin V1b receptor (AVPR1B)-VLPs

CSB-MP002469HU(A4)
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
Pls inquire
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
AVPR1B
Uniprot NO.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-424aa
Target Protein Sequence
MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQPRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAETIIF
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it's possible to develop.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, may recognize and internalize the complex formed by AVP/Arg-vasopressin, SARS-CoV-2 spike protein and secreted ACE2 through DNM2/dynamin 2-dependent endocytosis.
Gene References into Functions
  1. Patients were different from those previously studied. We measured the expression of the pituitary-specific hormone genes and type 1 corticotrophin-releasing hormone and arginine vasopressin 1b receptors, by quantitative real-time polymerase chain reaction using TaqMan probes. PMID:29979686
  2. Polymorphisms of CRHR1 and AVPR1b may modify susceptibility to mood disorders. PMID:23962971
  3. The results suggest that the AVPR1B gene rs28373064 is linked to emotional empathy and prosociality. PMID:26354157
  4. AA genotype of rs28418396 single-nucleotide polymorphism near the arginine vasopressin receptor 1b gene is associated with serious adverse events in patients with septic shock treated with vasopressin and norepinephrine. PMID:24919159
  5. Genetic variance of arginine vasopressin receptor 1B(AVPR1B) contributes to overweight and data indicate a link between AVPR1B variance and diabetes mellitus development PMID:26503846
  6. The association of AVPR1B G*A-haplotype (rs28632197 and rs33911258, respectively) and decreased Self-transcendence (TCI-125) was demonstrated in the total sample and in Udmurts. PMID:25438555
  7. Participants carrying both GG/GA variant of AVPR1b rs28373064 and AA variant of clock rs6832769 showed highest scores on the Emotional prosocial tendency measure. the clock gene and OXT/AVP systems are intertwined and contribute to human prosociality. PMID:25309987
  8. The associations of the AVP 1B receptor may be specific to reactive, emotional rather than proactive or callous types of aggression. PMID:24842238
  9. association between polymorphisms of AVPR1b gene and psychotic dimension.possible involvement of the AVPR1b gene in the etiology of psychotic features in the course of affective disorders PMID:24012103
  10. AVPR1B genetic variation has a role in suicide attempt etiology characterized by elevated depression levels. PMID:23422793
  11. The results of thi study showed that no association was found for alleles, genotypes, or haplotype analysis for AVPR1b genes and melancholic depression. PMID:23068076
  12. This is the first report of a genetic association between vasopressin receptor 1B and child aggression. PMID:22910476
  13. polymorphism rs28536160 genotype TT of the AVPR1b gene may increase susceptibility for obtaining psychotic features in the course of bipolar disorder I. PMID:22341483
  14. the presence of V1b receptors also found in human Langerhans islets could suggest hormonal control of AVP in human pancreas. PMID:12736162
  15. Data supports a protective effect of this major haplotype for recurrent major depression. PMID:15094789
  16. determination of a C-terminal motif required for export to plasma membrane PMID:15528211
  17. V1bR and CRHR1 can form constitutive homo- and heterodimers. PMID:17318384
  18. study found evidence to implicate the AVPR1B gene in the etiology of mood disorders, particularly in females PMID:17909131
  19. polymorphisms in the AVPR1B and the CRHR1 genes alter the susceptibility to panic disorder PMID:18384079
  20. AVPR1B is associated with autistic traits, empathy, and Asperger syndrome. PMID:19598235
  21. An association analysis with AVPR1b single-nucleotide polymorphism for attention deficit hyperactivity disorder, was performed in a patient/control sample. PMID:19668115

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Database Links

HGNC: 896

UNIGENE: Hs.1372

KEGG: hsa:553

STRING: 9606.ENSP00000356094

OMIM: 600264

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products