Recombinant Human V-type proton ATPase 16 kDa proteolipid subunit c (ATP6V0C)

Code: CSB-CF002389HU
Size:
20μg
20μg100μg
US$4020
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ATP6V0C
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-155
Target Protein Sequence
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Gene References into Functions
  1. Results found that the expression of ATP6V0C was higher in prostate cancer (PC) cell lines with high metastatic potential than that with low metastatic potential, indicating that ATP6V0C enhanced metastatic capacity in prostate cancer cells. Its silencing effectively suppressed the migration and invasion of PC cells through the inhibition of the function of V-ATPase, not through a LASS2/TMSG1-dependent manner. PMID:29138865
  2. RBP2 could induce epithelial-mesenchymal transition in esophageal cancer cells and exert a greater effect on the expression of E-cadherin in lung squamous cells than in esophageal squamous cells. PMID:26264242
  3. Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer. PMID:26110566
  4. The consequences of pharmacological inhibition of v-ATPase (by concanamycin) on proliferation, migration, VEGF-receptor 2 (VEGFR2) trafficking and signaling, as well as Notch-mediated transcription in endothelial cells, were examined. PMID:24254321
  5. A role for ATP6V0C in maintaining constitutive and stress-induced ALP function. PMID:24695574
  6. siRNA knockdown of ATP6V0C resulted in almost complete loss of infectious virus production, suggesting that an human cytomegalovirus microRNA targets a crucial cellular factor required for virus replication. PMID:24385903
  7. Results show that inhibition of V-ATPase by archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo. PMID:24166050
  8. results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPase PMID:22991218
  9. data suggest that the bacterial effector VepA targets subunit c of V-ATPase and induces the rupture of host cell lysosomes and subsequent cell death. PMID:22829766
  10. ATP6L has a protective role against SNP-induced autophagic cell death via inhibition of JNK and p38 in GSH-depleted glial cells. PMID:21433058
  11. Novel recessive myoclonic epilepsy candidate gene myoclonic epilepsy , but no mutation was found. PMID:21087195
  12. HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells. PMID:19875448
  13. 16K expression inhibits beta(1) integrin surface expression and spreading on matrix by a novel mechanism that results in reduced levels of functional beta(1) integrin PMID:15466867
  14. tumor acidity has a role in regulating inhibits the expression of ATP6L mRNA and protein in breast tumor cells PMID:19299075

Show More

Hide All

Subcellular Location
Vacuole membrane; Multi-pass membrane protein.
Protein Families
V-ATPase proteolipid subunit family
Database Links

HGNC: 855

UNIGENE: Hs.389107

KEGG: hsa:527

STRING: 9606.ENSP00000329757

OMIM: 108745

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products