MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Gene References into Functions
Results found that the expression of ATP6V0C was higher in prostate cancer (PC) cell lines with high metastatic potential than that with low metastatic potential, indicating that ATP6V0C enhanced metastatic capacity in prostate cancer cells. Its silencing effectively suppressed the migration and invasion of PC cells through the inhibition of the function of V-ATPase, not through a LASS2/TMSG1-dependent manner.PMID:29138865
RBP2 could induce epithelial-mesenchymal transition in esophageal cancer cells and exert a greater effect on the expression of E-cadherin in lung squamous cells than in esophageal squamous cells.PMID:26264242
Data show that 1-acylglycerol-3-phosphate O-acyltransferase 9 (AGPAT9) inhibit cell growth by regulating expression of KLF4/LASS2/V-ATPase proteins in breast cancer.PMID:26110566
The consequences of pharmacological inhibition of v-ATPase (by concanamycin) on proliferation, migration, VEGF-receptor 2 (VEGFR2) trafficking and signaling, as well as Notch-mediated transcription in endothelial cells, were examined.PMID:24254321
A role for ATP6V0C in maintaining constitutive and stress-induced ALP function.PMID:24695574
siRNA knockdown of ATP6V0C resulted in almost complete loss of infectious virus production, suggesting that an human cytomegalovirus microRNA targets a crucial cellular factor required for virus replication.PMID:24385903
Results show that inhibition of V-ATPase by archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo.PMID:24166050
results contribute to the conclusion that LASS2/TMSG1 could regulate V-ATPase activity and intracellular pH through the direct interaction of its homeodomain and the C subunit of V-ATPasePMID:22991218
data suggest that the bacterial effector VepA targets subunit c of V-ATPase and induces the rupture of host cell lysosomes and subsequent cell death.PMID:22829766
ATP6L has a protective role against SNP-induced autophagic cell death via inhibition of JNK and p38 in GSH-depleted glial cells.PMID:21433058
Novel recessive myoclonic epilepsy candidate gene myoclonic epilepsy , but no mutation was found.PMID:21087195
HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells.PMID:19875448
16K expression inhibits beta(1) integrin surface expression and spreading on matrix by a novel mechanism that results in reduced levels of functional beta(1) integrinPMID:15466867
tumor acidity has a role in regulating inhibits the expression of ATP6L mRNA and protein in breast tumor cellsPMID:19299075