MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS SCSPQPTDSLVLAPAAPARPAPEGPRAPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
High affinity receptor for urotensin-2 and urotensin-2B. The activity of this receptor is mediated by a G-protein that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
ligand-induced activation of the chemokine receptor CXCR4 and the urotensin 2 receptor UTS2R, triggers a marked reduction in the biogenesis of autophagosomes.PMID:27715446
The role of Urotensin-II receptor in vasoconstriction and in the development of digestive tract cancersPMID:27338741
UII/GPR14 signaling was involved in the DSS-induced colonic inflammation and its inhibition may serve as a potential therapeutic target, which may be associated with the NF-kappaB signaling pathway.PMID:27600191
UTII-R expression on biopsy was associated with Gleason upgrading and pathology upstaging in prostate cancer patients.PMID:26381851
Urotensin II can induce the proliferation of BEL-7402 cells via the urotensin receptor mediated PKC/ERK/p38 MAPK signaling pathways.PMID:25514221
Report interaction of urantide with urotensin II receptor.PMID:24357333
UTR protein and mRNA levels were increased in colon cancer cell lines and in colon adenoma and adenocarcinoma. UTR appears to be involved in the regulation of colon cancer cell invasion and motility.PMID:24372535
High UTR expression is an independent prognostic factor of good prognosis for non muscle invasive bladder transitional cancer.PMID:24893613
family-based analysis of association between blood pressure, glomerular filtration and genes of the urotensin-II pathway (urotensin-II, urotensin-II related peptide, urotensin-II receptor) saturated with 28 tagging single nucleotide polymorphismsPMID:24391740
Data suggest that UTS2R in aortic endothelium is involved in development of diabetes-associated atherosclerosis; diabetes-associated plaque development is attenuated by urotensin II/UTS2R antagonism in in vitro setting.PMID:23344731
presence of functional nuclear UT in various rat and monkey tissues as well as in human cell linesPMID:22245063
Urotensin II receptor predicts the clinical outcome of prostate cancer patients and is involved in the regulation of motility of prostate adenocarcinoma cells.PMID:21080343
hUII may deteriorate monocrotaline-induced cardiac hypertrophy mainly through a vasoconstriction of the pulmonary artery and partly through the suppression of ANP secretion.PMID:20870804
This study demonstrates that UT receptor is expressed on the endothelium of HCC. U-II/UT receptor system is involved in HCC function and it involves endothelium and NO pathway.PMID:19788716
An increased sensitivity to U-II in preeclampsia might be achieved by upregulation of placental U-II receptors.PMID:20479331
These findings suggest that the intrahepatic UII/UT system has an important pathophysiological role in cirrhosis and portal hypertension.PMID:20428787
urotensin II receptor (U2R) is up-regulated by interferon-gammaPMID:14753294
monocytes and macrophages were the largest producers of GPR14 mRNA, with relatively little expression in foam cells, lymphocytes, and platelets.PMID:15306183
Subjects with S89N amino acid substitution are more insulin-resistant and thus more susceptible to type 2 diabetes mellitus development.PMID:15476949
Since both mRNA for UT receptor and U-II binding were still present. ANG II receptors were also present as shown by ANG II-induced calcium mobilization.PMID:15752584
Diagnostic reagent kits using human rhabdomyosarcoma cells expressing UTS2R were compared.PMID:17537987
GPR14 is a candidate for the guanylate cyclase independent receptor for guanylin peptides.PMID:17595527
Cloning and functional characterization of the human UT receptor gene promoter revealed the presence of NF-kappaB-binding sites involved in UT receptor gene expressionPMID:17617581
Data show that both urotensin II and urotensin II receptor are expressed in adrenal tumors and attached non-neoplastic adrenal tissues, and suggest possible roles of UII and UT-R in tumor growth and/or secretion.PMID:17686550
REsults describe the differential expression of urotensin II receptors in cardiovascular tissues from rats and humans and suggest that it may account for the diverse vascular actions reported for urotensin-II.PMID:17905478
To understand the molecular interactions of hU-II and certain antagonists with the hUT-II receptor, a model of the hUT-II receptor in an active conformation with all its connecting loops was constructed by homology modeling.PMID:18409194
Results describe the solution structure of urotensin-II receptor extracellular loop III and characterize its interaction with urotensin-II.PMID:18423797
Urotensin II receptor activation in vivo enhanced the adrenocortical expression of immunoreactive aldosterone synthase.PMID:19001524
Demonstrate an important role for UTS2R in the pathogenesis of atherosclerosis. The use of UTS2R receptor antagonists may provide a beneficial tool in the management of this debilitating disease process.PMID:19111831
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Most abundant expression in the heart and pancreas.