Home
Product
Protein
Transmembrane Proteins
Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Recombinant Human Tumor suppressor candidate 3 (TUSC3)

Code: CSB-CF025352HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4792

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TUSC3

Uniprot NO.

Q13454

Alternative Names

TUSC3; N33; Tumor suppressor candidate 3; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; Oligosaccharyl transferase subunit TUSC3; Magnesium uptake/transporter TUSC3; Protein N33

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

42-348

Target Protein Sequence

QKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSV CRQANEEYQILANSWRYSSAFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPK RADTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNN LEFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES HIILVLNAAITMGMVLLNEAATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYP YSDLDFE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Acts as accessory component of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Involved in N-glycosylation of STT3B-dependent substrates. Specifically required for the glycosylation of a subset of acceptor sites that are near cysteine residues; in this function seems to act redundantly with MAGT1. In its oxidized form proposed to form transient mixed disulfides with a glycoprotein substrate to facilitate access of STT3B to the unmodified acceptor site. Has also oxidoreductase-independent functions in the STT3B-containing OST complex possibly involving substrate recognition.; Magnesium transporter.

Gene References into Functions

miR-UL112-3p exerts its oncogene function by directly targeting TUSC3 in Glioblastoma. PMID:28303930
study demonstrated an oncogenic role of TUSC3 in Non-small cell lung cancer and showed that dis-regulation of TUSC3 may affect tumour cell invasion and migration through possible involvement in the Hedgehog (Hh) signalling pathway. PMID:28487226
TUSC3 may act as an oncogene in the progression of colorectal cancer. PMID:30115537
TUSC3 can function both as an oncogene and as a tumor suppressor. (Review) PMID:28929175
our data indicate that miR-132 induces temozolomide resistance and promotes the formation of cancer stem cell phenotypes by targeting TUSC3 in glioblastoma. PMID:28901390
This paper supports the previous clinical descriptions of the condition caused by TUSC3 mutations and describes the seventh family with mutations in this gene, thus contributing to the genetic spectrum of mutations. This is the first report of a family from the Arabian peninsula with this form of Intellectual disability . PMID:27148795
SOX2 regulates the proliferation, migration and invasiveness of breast cancer cells through miR-181a-5p and miR-30e-5p which modulate TUSC3 protein levels PMID:28288641
Decreased Tumor Suppressor Candidate 3 Predicts Poor Prognosis of Patients with Esophageal Squamous Cell Carcinoma PMID:27994502
TUSC3 regulates proliferation and invasion of glioblastoma cells by inhibiting the activity of the Akt signaling pathway. PMID:27177902
decreased immunological TUSC3 staining is a factor prognostic of poor survival in pancreatic cancer patients. PMID:26871953
The TUSC3 gene is associated with mental retardation in the Qinba mountain area in China; the sixth exon of the TUSC3 gene may contribute to the risk of developing the disease. PMID:25966277
Report frequencies of short tandem repeat markers linked to TUSC3 (MRT7) or NSUN2 (MRT5) genes used for homozygosity mapping of recessive intellectual disability. PMID:26427135
TUSC3 loss alters the ER stress response and accelerates prostate cancer growth in vivo PMID:24435307
Loss of TUSC3 alters the molecular response to endoplasmic reticulum stress. PMID:25735931
IGFII and N33 methylation status may be related to gastric carcinogenesis. PMID:25086101
TUSC3 increases glycosylation efficiency for a subset of human glycoproteins by slowing glycoprotein folding. PMID:24685145
Homozygous deletion in TUSC3 causes syndromic intellectual disability. PMID:23825019
TUSC3 is a tumor suppressor gene in ovarian cancer. PMID:23404293
Genotyping and linkage analysis excluded linkage of the GRIK2 gene and TUSC3 gene with mental retardation. PMID:21557188
A novel nonsense mutation in TUSC3 is responsible for non-syndromic autosomal recessive mental retardation PMID:21739581
analysis of a novel deletion mutation in the TUSC3 gene in a consanguineous Pakistani family that may have a role in autosomal recessive nonsyndromic intellectual PMID:21513506
These findings suggest that inactivation through methylation of the putative tumor suppressor genes N-33 may not be associated with colorectal carcinogenesis in UC. PMID:20505342
Down regulated in ovarian cancer or absent in ovarian cancer and impact survival. PMID:16270321
N33, STK11 (19p13) and TP53 might play a role in the development of metastasis in larynx and pharynx squamous cell carcinomas. PMID:17641416
TUSC3 is only the fifth gene implicated in NS-ARMR and the first for which mutations have been reported in more than one family. PMID:18452889
study shows that mutations in two OTase-subunit genes, N33/TUSC3 and IAP result in autosomal-recessive nonsyndromic mental retardation PMID:18455129
Knockdown of either MagT1 or TUSC3 protein significantly lowers the total and free intracellular Mg(2+) concentrations in cell lines. PMID:19717468