Home
Product
Protein
Transmembrane Proteins
Recombinant Human Translocation protein SEC62 (SEC62)

Recombinant Human Translocation protein SEC62 (SEC62)

Code: CSB-CF857446HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5480

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SEC62

Uniprot NO.

Q99442

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-399

Target Protein Sequence

MAERRRHKKRIQEVGEPSKEEKAVAKYLRFNCPTKSTNMMGHRVDYFIASKAVDCLLDSK WAKAKKGEEALFTTRESVVDYCNRLLKKQFFHRALKVMKMKYDKDIKKEKDKGKAESGKE EDKKSKKENIKDEKTKKEKEKKKDGEKEESKKEETPGTPKKKETKKKFKLEPHDDQVFLD GNEVYVWIYDPVHFKTFVMGLILVIAVIAATLFPLWPAEMRVGVYYLSVGAGCFVASILL LAVARCILFLIIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSE TKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNG NDFEMITKEELEQQTDGDCEEDEEEENDGETPKSSHEKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Mediates post-translational transport of precursor polypeptides across endoplasmic reticulum (ER). Proposed to act as a targeting receptor for small presecretory proteins containing short and apolar signal peptides. Targets and properly positions newly synthesized presecretory proteins into the SEC61 channel-forming translocon complex, triggering channel opening for polypeptide translocation to the ER lumen.

Gene References into Functions

Results show higher SEC62 in the lymph node metastases from head and neck squamous cell carcinomas and cervical cancer of unknown primary patients compared with the primary tumor. Tumors from N1 to N3 stage exhibit increasing SEC62 expression in the lymphatic metastases. Its knockdown resulted in tumor cell line migration inhibition while, its overexpression stimulated cell migration. PMID:28002801
High Sec62 expression is associated with dysplastic cervical lesions. PMID:27553742
identify Sec62 as a critical molecular component in maintenance and recovery of endoplasmic reticulum homeostasis PMID:27749824
these studies identify TLOC1 and SKIL as driver genes at 3q26 and more broadly suggest that cooperating genes may be coamplified in other regions with somatic copy number gain. PMID:23764425
Sec62 overproduction significantly correlates with reduced non-small lung cancer patient survival. PMID:24304694
Phosphorylation of Sec63 by CK2 enhanced its binding to Sec62 PMID:23287549
Silencing the SEC62 gene inhibits post-translational transport of small presecretory proteins into endoplasmic reticulum. PMID:22375059
the Sec62-dependent translocation pathway serves as a fail-safe mechanism to ensure efficient secretion of small proteins and provides cells with an opportunity to regulate secretion of small proteins independent of the signal recognition particle pathway PMID:22648169
These results revealed that cyclin B1 and Sec62 may be candidate biomarkers and potential therapeutic targets for HBV-related HCC recurrence after surgery. PMID:22682366
The results indicate that SEC62 represents a potential candidate oncogene in the amplified 3q region in cases of non-small cell lung cancer. PMID:22197383
Our data indicate a crucial function of Sec62 in the response to thapsigargin-induced endoplasmic reticulum stress. PMID:21557272
after silencing of SEC62 the cell migration and the invasive potential of the cells was blocked or at least dramatically reduced while cell viability was hardly affected. SEC62 gene may indeed be considered a target gene in the therapy of various tumors PMID:20669223
The gene TLOC1/SEC62 revealed the highest frequency (50%) of copy number gains in the prostate cancer and was found to be up-regulated at the mRNA level. PMID:16547154