Recombinant Human Transient receptor potential cation channel subfamily V member 5 (TRPV5)

Code: CSB-CF885690HU
Size:
20μg
20μg100μg
US$7949
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
TRPV5
Uniprot NO.
Alternative Names
TRPV5; ECAC1; Transient receptor potential cation channel subfamily V member 5; TrpV5; Calcium transport protein 2; CaT2; Epithelial calcium channel 1; Osm-9-like TRP channel 3; OTRPC3
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-729
Target Protein Sequence
MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSV LRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLMEAAPELVFEPTTCEAFAGQTA LHIAVVNQNVNLVRALLTRRASVSARATGTAFRRSPRNLIYFGEHPLSFAACVNSEEIVR LLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGHGDHLQPLDLVPNHQG LTPFKLAGVEGNTVMFQHLMQKRRHIQWTYGPLTSILYDLTEIDSWGEELSFLELVVSSD KREARQILEQTPVKELVSFKWNKYGRPYFCILAALYLLYMICFTTCCVYRPLKFRGGNRT HSRDITILQQKLLQEAYETREDIIRLVGELVSIVGAVIILLLEIPDIFRVGASRYFGKTI LGGPFHVIIITYASLVLVTMVMRLTNTNGEVVPMSFALVLGWCSVMYFTRGFQMLGPFTI MIQKMIFGDLMRFCWLMAVVILGFASAFYIIFQTEDPTSLGQFYDYPMALFTTFELFLTV IDAPANYDVDLPFMFSIVNFAFAIIATLLMLNLFIAMMGDTHWRVAQERDELWRAQVVAT TVMLERKLPRCLWPRSGICGCEFGLGDRWFLRVENHNDQNPLRVLRYVEVFKNSDKEDDQ EHPSEKQPSGAESGTLARASLALPTSSLSRTASQSSSHRGWEILRQNTLGHLNLGLNLSE GDGEEVYHF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Constitutively active calcium selective cation channel thought to be involved in Ca(2+) reabsorption in kidney and intestine. Required for normal Ca(2+) reabsorption in the kidney distal convoluted tubules. The channel is activated by low internal calcium level and the current exhibits an inward rectification. A Ca(2+)-dependent feedback regulation includes fast channel inactivation and slow current decay. Heteromeric assembly with TRPV6 seems to modify channel properties. TRPV5-TRPV6 heteromultimeric concatemers exhibit voltage-dependent gating.
Gene References into Functions
  1. The alterations may lead to misfolding of TRPV5, reduction in translocation of the channel to the plasma membrane and/or impaired Ca(2+) transport function of the channel, and ultimately disrupt TRPV5-mediated Ca(2+) reabsorption. PMID:28847730
  2. These findings indicate that the A563T variation induces structural, dynamical, and electrostatic changes in the TRPV5 pore, providing structural insight into the functional alterations associated with the A563T variation. PMID:26837804
  3. Data found that a TRPV5 polymorphism (rs4236480) was observed to be associated with stone multiplicity of calcium nephrolithiasis, as the risk of stone multiplicity was higher in patients with the TT+CT genotype than in patients with the CC genotype PMID:26089600
  4. High TRPV5 expression is aassociated with adenoma of parathyroid glands. PMID:25164318
  5. Klotho up-regulates TRPV5 from both the inside and outside of cells. PMID:25378396
  6. Decreased expression of TRPV5 is associated with non-small cell lung cancer. PMID:24761864
  7. Upregulating the expression of TRPV5 can be utilized to manipulate transmembrane Ca2+ transport, and may serve as an alternative for the treatment of Ca2+ balance-related diseases. PMID:25139832
  8. Data indicate that transient receptor potential vanilloid type 5 (TRPV5) plasma membrane retention is regulated via lipid rafts. PMID:23970553
  9. urinary plasmin could contribute to the downstream effects of proteinuria on the tubulointerstitium by negatively modulating TRPV5 PMID:23024298
  10. apically secreted tissue transglutaminase functions as an inhibitor of TRPV5 and thereby contributes to the regulation of body Ca2+ homeostasis. PMID:21952826
  11. Data show that calmodulin negatively modulates TRPV5 activity, which is reversed by parathyroid hormone-mediated channel phosphorylation. PMID:21576356
  12. A calmodulin binding site was located in the C-termini of TRPV2 (654-683) and TRPV5 (587-616). PMID:20686800
  13. WNK4 and NHERF2 synergistically regulate TRPV5 by enhancing its forward trafficking and increasing its stability at plasma membrane, respectively. PMID:21187068
  14. G(2)/M cell cycle arrest was preceded by activation of TRPV5/6-like nonselective cation channels in the plasma membrane resulting in an elevated Ca(2+) entry as evident from fura-2 Ca(2+) imaging. PMID:21063097
  15. TRPV5 channel is susceptible for helix breaking mutations and the proximal intracellular region of TM5 of this channel plays an important role in Ca(2+)-dependent inactivation PMID:21035851
  16. Findings suggest that TRPV-5 contributes to maintaining the homeostasis of the human skeleton via a negative feedback loop in RANKL-induced bone resorption. PMID:20547482
  17. Functional properties of the epithelial Ca2+ channel, ECaC. PMID:11765215
  18. does not play a primary role in autosomal dominant hypercalciuria PMID:12198212
  19. Our results indicate that the pattern of CaT1 and CaT2 expression correlates with the Ca2+ uptake potential along the differentiation of cultured human trophoblasts isolated from term placenta PMID:12390878
  20. The epithelial Ca2+ channel TRPV5 is essential for proper osteoclastic bone resorption. PMID:16291808
  21. WNK4 positively regulates TRPV5-mediated Ca transport & inhibitory effect of thiazide-sensitive Na+Cl- cotransporter on this process may be involved in pathogenesis of hypercalciuria of familial hyperkalemic hypertension caused by gene mutation in WNK4. PMID:17018846
  22. TRPV5 is involved in regulation and function in renal Ca2+ reabsorption and overall Ca2+ homeostasis--{review} PMID:17217059
  23. malin ubiquitinates PTG in a laforin-dependent manner, both in vivo and in vitro, and targets PTG for proteasome-dependent degradation. These results suggest an additional mechanism, involving laforin and malin, in regulating glycogen metabolism PMID:18077461
  24. activation of protein kinase C increases cell surface abundance of TRPV5 by inhibiting endocytosis PMID:18305097
  25. review covers the distinctive properties and regulation of the highly Ca(2+)-selective TRPV5 channel and highlights the implications for our understanding of the process of Ca(2+) reabsorption. PMID:18596722
  26. This study was aimed at the mechanism underlying the difference in the effects of WNK4 on TRPV5 and TRPV6 through analyzing the difference in TRPV5 and TRPV6 expression in the plasma membrane. PMID:18703016
  27. Genotyping TRPV5 in renal hypercalciuria revealed three non-synonymous and five synonymous polymorphisms. Electrophysiological study of the TRPV5 mutants did not reveal significant functional changes compared to wild-type TRPV5 channel recordings. PMID:19131347
  28. The expression pattern and the selective Ca2+ permeation properties of TRPV5 channel indicate an important role of this channel in the Ca2+ homeostasis. PMID:19140341
  29. Activation of the CaR stimulates TRPV5-mediated Ca(2+) influx via a PMA-insensitive PKC isoform pathway. PMID:19157541
  30. the A563T variation in TRPV5 may contribute to the superior ability of renal Ca(2+) conservation in African Americans PMID:19261737
  31. Parathyroid hormone activates the cAMP-PKA signaling cascade, which rapidly phosphorylates threonine-709 of TRPV5, increasing the channel's open probability and promoting Ca(2+) reabsorption in the distal nephron. PMID:19423690

Show More

Hide All

Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, TrpV subfamily, TRPV5 sub-subfamily
Tissue Specificity
Expressed at high levels in kidney, small intestine and pancreas, and at lower levels in testis, prostate, placenta, brain, colon and rectum.
Database Links

HGNC: 3145

UNIGENE: Hs.283369

KEGG: hsa:56302

STRING: 9606.ENSP00000265310

OMIM: 606679

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products