TRPV2; VRL; Transient receptor potential cation channel subfamily V member 2; TrpV2; Osm-9-like TRP channel 2; OTRPC2; Vanilloid receptor-like protein 1; VRL-1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-764
Target Protein Sequence
MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNY RKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCL MKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVK LLVENGANVHARACGRFFQKGQGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQA TDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKL AAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCEENSVLEIIAF HCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALL TVVSQVLCFLAIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLL IYLVFLFGFAVALVSLSQEAWRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLEL FKFTIGMGELAFQEQLHFRGMVLLLLLAYVLLTYILLLNMLIALMSETVNSVATDSWSIW KLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDERWCFRVEEVNWASWEQTLPT LCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Calcium-permeable, non-selective cation channel with an outward rectification. Seems to be regulated, at least in part, by IGF-I, PDGF and neuropeptide head activator. May transduce physical stimuli in mast cells. Activated by temperatures higher than 52 degrees Celsius; is not activated by vanilloids and acidic pH.
Gene References into Functions
TRPV2 mediates IL-8 secretion and calcium signaling in testicular peritubular cells.PMID:30235802
TRPV2 expression was inversely correlated with CRP and TpI and directly correlated with serum IGF-1. We assume that peripheral TRPV2 downregulation occurs concomitantly with the accumulation of TRPV2-white blood cells in the peri-infarct zone. TRPV2 may thus represent a novel target for treatment in the acute phase after MI.PMID:29393104
the expression of transient receptor potential vanilloid-1 (TRPV1), transient receptor potential vanilloid-2 (TRPV2) and transient receptor potential vanilloid-3 (TRPV3) channels in native human odontoblasts, was examined.PMID:28905239
High TRPV2 expression is associated with breast cancer.PMID:26993604
Binding of capsaicin to TRPV2_Quad antagonizes resiniferatoxin-induced activation likely through competition for the same binding sites.PMID:27298359
both TRPV2 and TRPV4 are involved in migration of human cardiac c-kit(+) progenitor cells.PMID:26865051
The results of the study show that polymorphism of TRPV2 influenced the susceptibility to FM.PMID:27079220
CGRP- and TRPV2-containing trigeminal neurons probably innervate the paranasal sinus mucosae, and project into spinal and principal trigeminal sensory nuclei.PMID:27553072
transient receptor potential vanilloid 2 is an intracellular Ca(2+)-permeable transient receptor potential vanilloid channel upregulated by nerve growth factor via the mitogen-activated protein kinase signaling pathway to augment neurite outgrowth.PMID:26416880
Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4PMID:25333484
There appears to be TRPV1- or TRPV2-IR sympathetic pathway in the human stellate ganglion and spinal cord.PMID:25641129
This study evaluated the role of Trpv2 in arthritis and the pharmacological effects of Trpv2 agonists.PMID:25869297
High expression of TRPV2 mRNA was closely associated with advanced pathological stage and worse survival of patients with esophageal squamous cell carcinoma.PMID:24878697
Aim of this review is to study the role of the TRPV2 channel, a member of the TRPV subfamily of TRP channels, in tumor progression. [review]PMID:25001513
TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nervePMID:24764033
Data indicate that transient receptor potential vanilloid 2 (TRPV2) siRNA virtually abolished stretch-activated current.PMID:25268680
An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca(2) rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria.PMID:24475260
Sarcolemmal TRPV2 accumulation appears to have considerable pathological impact on Dilated cardiomyopathy (DCM) progression.PMID:23786999
The addition of TRPV2 inhibitor Tranilast in the incubation medium prevent the calcium influx triggered by lysoPC and reduced lysoPC-induced cytotoxicity,whereas TRPV4 inhibitor RN 1734 was without effectPMID:23964684
TRPV2 mediates adrenomedullin stimulation of prostate and urothelial cancer cell adhesion, migration and invasion.PMID:23741410
TRPV1 and TRPV2 are potential targets for potential therapeutic interventions in cardiovascular disease.PMID:23453732
Duchenne muscular dystrophy primary human myotubes exhibit abnormal elevation of TRPV2-dependant cation entry.PMID:23426965
TRPV2 plays a key role in mast-cell degranulation in response to mechanical, heat and red laser-light stimulation.PMID:21574765
The increased expression of TRPV2 gene in peripheral lymphocytes is closely correlated with childhood asthma in the north of China.PMID:23294145
TRPV2-coupled signaling as a key player in mediating the cellular actions of heat shock on DCsPMID:23542034
Cultivated HCjE cells and human conjunctiva express TRPV2, mRNA.PMID:22327830
Human corneal epithelial cells possess thermosensitive TRPV2 activity.PMID:21506114
A calmodulin binding site was located in the C-termini of TRPV2 (654-683) and TRPV5 (587-616).PMID:20686800
Decrease in membrane phosphatidylinositol 4,5-bisphosphate (PIP2) levels on channel activation underlies a major component of divalent calcium ion-dependent desensitization of TRPV2 and may play a similar role in other TRP channels.PMID:20926660
TRPV2 negatively controls glioma cell survival and proliferation, as well as resistance to Fas-induced apoptotic cell death in an ERK-dependent manner.PMID:20093382
Findings establish a role for TRPV2 in PCa progression to the aggressive castration-resistant stage, prompting evaluation of TRPV2 as a potential prognostic marker and therapeutic target in the setting of advanced PCa.PMID:20103638
TRPV2 plays a role in human hepatocarcinogenesis and might be a prognostic marker of patients with hepatocellular carcinoma (HCC).PMID:20113837
TRPV2 and PKA have roles as a signaling module for transduction of physical stimuli in mast cellsPMID:15249591
It is concluded that PI3-kinase induces or modulates the activity of recombinant TRPV2 channels; in contrast to the previously proposed mechanism, activation of TRPV2 channels by PI3-kinase is not due to channel translocation to the plasma membrane.PMID:16533525
Both TRPV1 and TRPV2 are found in human peripheral blood lymphocytes.PMID:16777226
The TRPV2 ARD provides the first structural insight into a domain that coordinates nociceptive sensory transduction and is likely to be a prototype for other TRPV channel ARDsPMID:16882997
A progressive loss of s-TRPV2 accompanied by an increase of hTRPV2 expression was found in high-grade and -stage UC.PMID:17977643
Messenger RNA transcripts of TRPVs 1 through 4 are detected for the first time in human pulmonary artery smooth muscle cells.PMID:18787888
relative gene expression ofTRPV1-4 in leukocytes is: TRPV3 < TRPV4, TRPV1 and TRPV2; leukocytes in hyposensitive subjects showed up-regulation of TRPV1, which was almost doubly expressedPMID:18983665
The reduction of TRPV2 and TRPM8 immunoreactive nerve fibers in skin from individuals with Norrbottnian congenital insensitivity to pain further suggests that these ion channels are expressed primarily on nociceptive primary sensory neurons.PMID:19482060
TRPV1-immunoreactivity was significantly higher and TRPV2-immunoreactivity was significantly lower in peripheral blood mononuclear cells from end-stage kidney disease patients compared to controls.PMID:19619644