Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 43 (TAS2R43)

Recombinant Human Taste receptor type 2 member 43 (TAS2R43)

Code: CSB-CF023161HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4807

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R43

Uniprot NO.

P59537

Alternative Names

TAS2R43; Taste receptor type 2 member 43; T2R43; Taste receptor type 2 member 52; T2R52

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-309

Target Protein Sequence

MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLW VLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVT MVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYW VKGEKTSSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Gustducin-coupled receptor immplicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. Activated by the sulfonyl amide sweeteners saccharin and acesulfame K. In airway epithelial cells, binding of bitter compounds increases the intracellular calcium ion concentration and stimulates ciliary beat frequency. May act as chemosensory receptors in airway epithelial cells to detect and eliminate potential noxious agents from the airways.

Gene References into Functions

those with at least one sensitive TAS2R38 allele (AP or PP genotype) were more likely to report rejecting liquid medications than were those without a taster allele (AA genotype PMID:26391354
Study demonstrates that the response profiles of the cat bitter receptors Tas2r38 and Tas2r43 are distinct from those of their orthologous human receptors PMID:26037485
The effect of the TAS2R43 gene on coffee liking is mediated by caffeine and in particular by the H212R variant. PMID:24647340
Studies indicate that bitter-tasting compounds can have specific physiological effects in Bitter-tasting compounds can have specific physiological effects in type 2 taste receptors (T2Rs)-expressing cells. PMID:22964302
The mutational polymorphism TAS2R43 significantly affects susceptibility to BEN points to a potentially broad role for toxin responses in personal health risks. PMID:23050764
Our results show that the expression rate of some of the T2R taste receptor genes was increased significantly in patients with phantogeusia. PMID:22397221
hTAS2R43 and hTAS2R44 function as cognate bitter taste receptors and do not contribute to the sweet taste of saccharin and acesulfame K. PMID:15537898
hT2R43 gene allele makes people more sensitive to the bitterness of an artificial sweetener, saccharin; in addition, a closely related gene's (hT2R44's) allele also makes people more sensitive to the bitterness of saccharin. PMID:17702579