Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 39 (TAS2R39)

Recombinant Human Taste receptor type 2 member 39 (TAS2R39)

Code: CSB-CF023156HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5024

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R39

Uniprot NO.

P59534

Alternative Names

TAS2R39; Taste receptor type 2 member 39; T2R39; Taste receptor type 2 member 57; T2R57

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-338

Target Protein Sequence

MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHA AEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINIC TVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIM AAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.

Gene References into Functions

hTAS2R39 is the primary receptor for the bitterness of theaflavins PMID:25273142
TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids. PMID:21942422
Human bitter taste receptors hTAS2R8 and hTAS2R39 display differential functions to recognize bitter peptides. PMID:21670512
these results suggest the participation of hTAS2R39 in the detection of catechins in humans. PMID:21272567