Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 16 (TAS2R16)

Recombinant Human Taste receptor type 2 member 16 (TAS2R16)

Code: CSB-CF885768HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4672

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R16

Uniprot NO.

Q9NYV7

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-291

Target Protein Sequence

MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILISLGISRFCLQ WASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHLPRNSTVTDKLENFHQYQFQA HTVALVIPFILFLASTIFLMASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.

Gene References into Functions

We did not find any statistically significant association between risk of developing sporadic colorectal cancer and selected single nucleotide polymorphisms. However, after stratification by histology (colon vs. rectum) we found that rs1525489 was associated with increased risk of rectal cancer with a (Ptrend of = 0.0071). PMID:28915899
genetic association studies in populations in Northern Europe, Maghreb, and Sri Lanka: Data suggest that SNPs in TAS2R50 (rs1376251), TRPM5 (rs800345), and TAS2R16 (rs860170) are associated with cultural food preferences; TAS2R16 (rs860170) strongly differentiates populations and is associated to salicin bitterness perception. (TRPM5 = transient receptor potential cation channel subfamily M member 5) PMID:28366770
Principal component analysis of binding energies for single-point mutants of hT2R16 bound to an agonist correlate with experimental mutant cell response. PMID:25393978
No significant association between rs702424 alleles and salicin bitter taste recognition, implying that this site does not contribute to salicin phenotypic variance. PMID:24785689
Results showed that individuals with at least one derived T-allele at polymorphic site 516 have a higher sensitivity to salicin bitterness compared with individuals homozygous for the ancestral G-allele. PMID:24177185
Bitter taste receptor polymorphisms in TAS2R16 may be associated with human aging PMID:23133589
The authors discuss the association between the TAS2R16 gene and the evolution of bitter taste receptors in different populations. PMID:21740153
TAS2R16 is responsible for the bitterness of gentiobiose. PMID:20965151
molecular interaction between hTAS2R16 and beta-D-glucopyranoside PMID:20605788
TAS2R16 is present in taste receptor cells on the tongue and is activated by bitter beta-glucopyranosides, and mediates bitter taste PMID:12379855
Functional variant in a bitter-taste receptor (hTAS2R16) influences risk of alcohol dependence, especially in African-Americans. PMID:16385453
Functional variants in both TAS2R16 and TAS2R38 correlate with alcohol consumption in African-American families. PMID:17250611