TAS2R14; Taste receptor type 2 member 14; T2R14; Taste receptor family B member 1; TRB1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-317
Target Protein Sequence
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRESS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
Gene References into Functions
We observed that the homozygous carriers of the (G) allele of the TAS2R14-rs3741843 polymorphism showed a decreased sperm progressive motility compared to heterozygotes and (A) homozygotes.PMID:29040583
These data indicate that, unlike in taste cells, TAS2Rs couple to the prevalent G proteins, Galphai1, Galphai2, and Galphai3, with no evidence for functional coupling to Galphagust.PMID:28145731
Heterologously expressed T2R14 responds to multiple flavones. These flavones also activate T2R14-driven calcium signals in primary cells that activate nitric oxide production to increase ciliary beating and mucociliary clearance.PMID:28373278
Thus the beta2AR acts as a double-edged sword: increasing TAS2R14 cell surface expression, but when activated by beta-agonist, partially offsetting the expression phenotype by direct receptor:receptor desensitization of TAS2R14 function.PMID:27342779
Probing the Binding Pocket of the Broadly Tuned Human Bitter Taste Receptor TAS2R14 by Chemical Modification of Cognate Agonists.PMID:26825540
TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids.PMID:21942422
These results point to a potential route of action by which components of Hoodia might influence appetite control; the natural taste receptor antagonist was identified for further studies as an appetite suppressant.PMID:20930049
no evidence of statistically significant associations between polymorphisms in the TAS2R14 gene and colon cancer riskPMID:20534144
Show
More
Hide
All
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor T2R family
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in testis.