Home
Product
Protein
Transmembrane Proteins
Recombinant Human Taste receptor type 2 member 14 (TAS2R14)

Recombinant Human Taste receptor type 2 member 14 (TAS2R14)

Discontinued

Code: CSB-CF868362HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6326

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

TAS2R14

Uniprot NO.

Q9NYV8

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-317

Target Protein Sequence

MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISRISLVW LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAMFLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFFLLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRESS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.

Gene References into Functions

We observed that the homozygous carriers of the (G) allele of the TAS2R14-rs3741843 polymorphism showed a decreased sperm progressive motility compared to heterozygotes and (A) homozygotes. PMID:29040583
These data indicate that, unlike in taste cells, TAS2Rs couple to the prevalent G proteins, Galphai1, Galphai2, and Galphai3, with no evidence for functional coupling to Galphagust. PMID:28145731
Heterologously expressed T2R14 responds to multiple flavones. These flavones also activate T2R14-driven calcium signals in primary cells that activate nitric oxide production to increase ciliary beating and mucociliary clearance. PMID:28373278
Thus the beta2AR acts as a double-edged sword: increasing TAS2R14 cell surface expression, but when activated by beta-agonist, partially offsetting the expression phenotype by direct receptor:receptor desensitization of TAS2R14 function. PMID:27342779
Probing the Binding Pocket of the Broadly Tuned Human Bitter Taste Receptor TAS2R14 by Chemical Modification of Cognate Agonists. PMID:26825540
TAS2R14 and TAS2R39 were activated by isoflavones and other isoflavonoids. PMID:21942422
These results point to a potential route of action by which components of Hoodia might influence appetite control; the natural taste receptor antagonist was identified for further studies as an appetite suppressant. PMID:20930049
no evidence of statistically significant associations between polymorphisms in the TAS2R14 gene and colon cancer risk PMID:20534144