QSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Gene References into Functions
Data confirm previous findings that the CD247 polymorphisms are mainly associated with the clinical outcome of systemic lupus erythematosus and less with susceptibility.PMID:30064597
analysis of the assembly and surface expression of FcepsilonR1alpha in cells shows that CD16A associates equally well with human CD247 and FcepsilonR1gamma homodimersPMID:28652325
Long-term lung function decline in asthma is associated with elevation of bronchial CD8 and CD4 at baseline, and CD8, CD3 and granzyme B at follow-upPMID:27230446
Crk-dependent increased phosphorylation of CD3zeta coincided with inhibition of TCR downmodulation, supporting a positive role for Crk adaptor proteins in TCR-mediated signal amplification.PMID:28465009
the immunohistochemical staining patterns of CD3 and CD20 in Malignant Lymphoma Cells, were investigated.PMID:28442514
CD274 up-regulation in new-onset type 1 diabetes mellitusis correlated with disease pathogenesis.PMID:28577136
our observations suggested that CD247 gene polymorphism (rs858554) may associated with the susceptibility of RA.PMID:27118209
CD3/28-activated T cells expanded in IL-7 and IL-15 produced greater expansion of memory stem T cells and central memory T cell-derived T cells compared with IL-2. Our strategy provides a powerful tool to elucidate the characteristics of CAR-modified T cells, regardless of the protocol used for expansion, reveals the functional properties of each expanded T cell subset.PMID:28550199
Multiple mutations were found in CD247 complementary DNAs (cDNAs) cloned from the patient as well as in cDNA and genomic DNA from other individuals, suggesting that genetic variation in this gene is frequent.PMID:28743717
Single-nucleotide polymorphism in CD247 gene is associated with sclerotic graft-versus-host disease.PMID:27313329
CD3Z hypermethylation was significantly correlated with SLE. CD3Z hypermethylation is an SLE risk factor that can be modified by environmental factors and is associated with more severe SLE clinical manifestations, which are related to deranged T cell function by downregulating the CD3zeta-chain.PMID:27940592
Linkage and association studies revealed a chromosomal region in which a novel type 1 diabetes (T1D)/autoimmune thyroid disease (AITD) susceptibility gene, CD247, is located and showed association between T1D/AITD and several variants in this gene. These results suggests that common susceptibility genes act in concert with variants of CD247 to generate genetic risk for T1D/AITD in this population.PMID:27716086
SRSF1 regulates CD3zeta expression in human T cells and may contribute to the T cell defect in systemic lupus erythematosus.PMID:26134847
In localized colorectal cancer carriers, mRNA-based CD3Z/CD8 profiling of tumor immune response may have stage, site and tissue-specific prognostic significance, along with ESR1 expression.PMID:25970543
identified among the key genes in circulating monocytes that were altered by exercisePMID:26207425
Our study independently confirms and extends the association of SLE with CD247, which is shared by various autoimmune disorders and supports a common T-cell-mediated mechanism.PMID:25569266
we observed decreased CD3 surface expression, reduced ZAP-70 abundance and increased histone H3-acetylation in activated T lymphocytes after 5 minutes of clinorotation and a transient downregulation of CD3 and stable downregulation of IL-2RPMID:25661802
T cell receptor (TCR)-CD3 complex and the Lck kinase were required for Ca(2+) mobilization but not for apoptosis induction in Jurkat cells.PMID:25947381
These findings confirm the role of PTPN22 and CD28 involved in the T cell activation pathway in the development of T1D in Tunisian families. Interestingly, ZAP70 and TCRbeta/CD3z seem to contribute to the susceptibility to the disease in our population.PMID:25448703
a CD247 defect leads to the accumulation of naive, hyporesponsive gammadelta and alphabeta T cells in thymoma patient resulting in a novel type of acquired T cell immunodeficiency and immune dysregulation of clinical significance.PMID:25732729
CD247 downregulation was associated with disease severity, complications, and the occurrence of future cardiovascular events, suggesting its potential use not only as a diagnostic but also as a prognostic biomarker.PMID:25368105
Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression.PMID:25513989
Myeloid-derived suppressor cell frequency in peripheral blood is directly correlated with the HCV RNA load in the plasma and inversely correlated with TCR zeta chain expression in CD8(+) T cells.PMID:24552712
Two transcription factor binding sites and a long non-coding RNA are identified within the Cd247 gene.PMID:24797614
LAT is a modulator of CD3zeta and ZAP-70 tyrosine phosphorylation.PMID:24204825
A deficient lipid rafts recruitment of CD3zeta/ZAP-70/Grb2, and these proteins do not merge with GM1 within the lipid rafts.PMID:23916875
Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk.PMID:23861880
A review of the possible roles of CD247 gene variants and single-nucleotide polymorphisms in systemic lupus erythematosus pathogenesis.PMID:23525753
Low expression of T-cell antigen receptor complex zeta is associated with chronic myeloid leukemia.PMID:23228155
Data indicate that TCRzeta gene transfection could restore TCRzeta chain deficiency and enhance IL-2 production in T cells from patients with chronic myeloid leukemia (CML).PMID:23057733
It was shown that CD8alpha/CD3zeta rescues pertussis toxin-induced signaling events lacking in TCR null cells, indicating that CD8alpha/CD3zeta can substitute for TCR and supports the hypothesis that pertussis toxin stimulates signaling via receptor cross-linking.PMID:22551306
These data provide evidence for src-like adaptor protein-dependent regulation of CD3 zeta-chain in the fine control of TCR signaling.PMID:22798681
The rs12133337 polymorphism in the CD3Z gene might affect the immune response to hepatitis B vaccination, and a lower BMI might increase the contribution of the polymorphism to immunity to hepatitis B vaccination.PMID:22536368
A novel juvenile idiopathic arthritis susceptibility locus was identified, CD247.PMID:22294642
peripheral blood lymphocytes (PBLs) of ovarian cancer patients showed lower JAK3, CD3-zeta molecules expression levels, as well as lower STAT3 and CD3-zeta phosphorylation levels than cells of control.PMID:22221142
The CD3-zeta chimeric antigen receptor overcomes TCR Hypo-responsiveness of human terminal late-stage T cells.PMID:22292024
Data show a significant association between variants in CD247 and systemic lupus erythematosus in Asian populations.PMID:22004975
CD247 as an systemic sclerosis susceptibility genePMID:21474487
The expression level of CD3zeta in chronic myeloid leukemia patients was lower than in controls.PMID:20723304
CD247 is a new susceptibility locus for systemic sclerosisPMID:20383147
ASF/SF2 as a novel factor in the regulation of alternative splicing of the 3'-UTR of CD3zeta and protein expression in human T cells.PMID:20118245
Blockade of B7-H1 greatly promoted the proliferation of CD3AK cells and extended the survival time of CD3AK cells in vitro.PMID:19664385
CD3zeta transcripts and protein were found to be absent from most solid tumor-TILs from patients with ovarian cancer, whereas they were expressed in ASC-TILs and PBMCs from such patients.PMID:20032419
T cells grafted with a recombinant CD3zeta/CD28 signaling receptor secrete high amounts of IL-2 upon antigen binding without exogenous B7/CD28 costimulation, demonstrating that complete T cell activation can be delivered by one chimeric receptor molecule.PMID:11714771
experimental, computational and evolutionary approaches predicts the presence of a tetrameric form for CD3-zetaPMID:11851345
Our data indicate that TCR-signaling pathways are differentially affected by physiological levels of oxidative stressPMID:11916964
reduced expression in tumor-infiltrating lymphocytes strongly correlated with progressive disease in gastric carcinomaPMID:11920499
Regulation of T cell receptor CD3zeta chain expression by L-arginine.PMID:11950832
Defective expression and altered tyrosine phosphorylation of TCR zeta was found in a large proportion of SLE patients, suggesting that it may play an important role in T cell dysfunction in SLE.PMID:12100036
ZAP-70, a tyrosine kinase known to be crucial for T cell activation, as a key player in TCR down-modulation and zeta degradation.PMID:12165490
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
CD3Z/FCER1G family
Tissue Specificity
CD3Z is expressed in normal lymphoid tissue and in peripheral blood mononuclear cells (PBMCs).