Recombinant Human T-cell-specific surface glycoprotein CD28 (CD28)

Code: CSB-CF004913HU
Size:
20μg
20μg100μg
US$4006
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CD28
Uniprot NO.
Alternative Names
CD28; T-cell-specific surface glycoprotein CD28; TP44; CD antigen CD28
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
19-220
Target Protein Sequence
NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation. Isoform 3 enhances CD40L-mediated activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells.
Gene References into Functions
  1. The results of this study indicated that the CD28 rs3116496 polymorphism might impact the risk of schizophrenia, especially deficit schizophrenia. PMID:28673752
  2. CD28 may be a tumor suppressor gene and rs3116496 polymorphism of CD28 gene showed positively correlation with the increased risk of breast cancer. PMID:29089469
  3. percentage of CD4(+) CD28(null) T-cells was significantly higher in type 1 diabetes patients with and without microvascular complications compared with controls PMID:28102614
  4. Suggest that genetic polymorphisms of CD28 function as sex-dependent risk factors for development of acute rejection in an Iranian kidney transplant population. PMID:28031007
  5. the expression of CD28 was lower in both Sjogren's syndrome and systemic sclerosis patients PMID:27878564
  6. The fraction of CD4(+)CD28(null) cells proved to be predictive on outcome in congestive heart failure-patients presenting with atrial fibrillation. PMID:27904907
  7. In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID:27530312
  8. These preliminary results suggest that patients undergoing liver or kidney transplant can be stratified at high risk of EAR according to their CD28 molecule expression on peripheral CD4(+) T lymphocytes. PMID:28392336
  9. The rs3116496 (T>C), rs3181098 (G>A) and rs3181100 (G>C) of CD28 were, respectively, found to be correlated with incremental susceptibility to recurrent spontaneous abortion under the allelic model. PMID:29069644
  10. Coexpression of CD200R-CD28 enhances function in WT1-specific T-cell receptor - transduced human primary T cells. PMID:29042364
  11. the upregulation of others syncytial molecules, including LAG3, CTLA4, CD28 and CD3, assisting the formation of syncytia with APC cells. PMID:27108398
  12. our data provide the first evidence of a strict link between the absence of CD28 and the expression of perforin, which is likewise enhanced by the expression of NKG2D, within selected CD4(+) T cells from cervical cancer patients. PMID:28087292
  13. Mutation of the basic clusters in the CD28 cytoplasmic domain reduced the recruitment to the CD28-Lck complex of protein kinase Ctheta; (PKCtheta;), which serves as a key effector kinase in the CD28 signaling pathway. PMID:27460989
  14. The mutant CD28 isoforms could accelerate tumor cell growth. PMID:28711152
  15. identified recurrent mutations in CD28 in peripheral T-cell lymphomas. Molecular modeling studies on each of these mutations suggested how these mutants result in increased affinities. PMID:26719098
  16. the scaffolding role of RLTPR predominates during CD28 co-stimulation and underpins the similar function of RLTPR in human and mouse T cells. PMID:27647348
  17. Our data show that mast cells can costimulate human CD4(+) T cells to induce strong T-cell proliferation, but that therapies aiming at disrupting the interaction of CD28 and B7 molecules do not inhibit mast cell mediated T-cell activation. PMID:26860071
  18. High CD28 Circulating Levels are associated with Breast Cancer. PMID:27381613
  19. The CTLA4-CD28 gene fusion is likely a major contributor to the pathogenesis of T-cell lymphomas and represents a potential target for anti-CTLA4 cancer immunotherapy. PMID:26819049
  20. Following phosphorylation of the tyrosine, the proteins growth factor receptor-bound protein 2 (Grb2), Grb2-related adaptor downstream of Shc (Gads), and p85 subunit of phosphoinositide 3-kinase may bind to pYMNM (where pY is phosphotyrosine) via their Src homology 2 (SH2) domains, leading to downstream signaling to distinct immune pathways. These three adaptor proteins bind to the same site on CD28 with variable affinity PMID:27927989
  21. CD28 family receptors are potential clinical indicators for the rapid monitoring of changes in T cell function during CHB treatment. PMID:27314219
  22. The eQTL mapping analysis revealed that the variations in CD28 and NFKB1 gene content might affect the abundance of transcripts of CD28 and Family with sequence similarity 177 member A1 (FAM177A1) genes, respectively. These results suggest that CD28 and NFKB1 gene variants may be associated with increased risks to IRM. PMID:27488439
  23. this study shows that CD28 contributes to rheumatoid arthritis susceptibility in Egyptian PMID:27125674
  24. A highly recurrent novel missense mutation in CD28 among angioimmunoblastic T-cell lymphoma patients. PMID:26405154
  25. These findings indicate that the associations of the CTLA-4 and CD28 polymorphisms with the risk of renal cancer are worth further study in a larger group of patients. PMID:26403483
  26. expansion of highly differentiated CD28null T cells is associated with a lower risk for early acute rejection after kidney transplantation PMID:26950734
  27. In patients presenting with acute coronary syndrome, the CD4 + CD28null T cell percentage was higher in patients with non-ST-segment-elevation acute coronary syndrome versus those with STEMI. PMID:26375412
  28. in complex with T cell receptor, promotes glycolysis PMID:26885860
  29. Data show that CD28 antigen costimulation modulates CD46 antigen surface expression on activated T cells. PMID:25787182
  30. study also uncovered a previously unappreciated role for Vav1 in crosstalk between the CD28 and TCR signaling pathways PMID:26043137
  31. Among CD8+ T-lymphocytes, CD28+CD57+ cells represent a subset with some senescent features that are distinct from the CD28-CD57+ cells. PMID:26277688
  32. The CD28 gene polymorphisms may not only act in immune deregulation observed in schizophrenia, but may also influence the course of the illness by modifying the susceptibility to the co-occurrence of psychotic and affective symptoms PMID:25998553
  33. CD28 polymorphism, rs3116496, contributes to cancer susceptibility in the case of multiple cancers. PMID:25534869
  34. The functional decline of invariant natural killer T cells was closely related to the decrease in CD28 expression and the increases of Tim-3 and PD-1. PMID:26215444
  35. Results showed lower and higher serum levels of CTLA4 and CD28 detected respectively in patients with colorectal cancer (CRC)and found an association of the CTLA4 -318C/T polymorphism in CRC patients. PMID:26408701
  36. analysis of signaling pathways activated by CD28 during direct cell-cell contact by global analysis of protein phosphorylation PMID:25829543
  37. Immature dendritic cells convert anergic nonregulatory T cells into Foxp3- IL-10+ regulatory T cells by engaging CD28 and CTLA-4. PMID:25382658
  38. our data provide evidence that Vav1 is the linker molecule that couples CD28 to PIP5Kalpha activation and strongly fit with a potential model in which CD28 regulates PIP2 synthesis and turnover in T lymphocytes. PMID:25539813
  39. Thus, aberrant CD28 expression on circulating CD8+ T cells and the CD8+CD28+/CD8+CD28- T cells ratio reflect the dysregulation of T cell activation and are related to the pathogenesis of chronic HBV infection. PMID:25013781
  40. Five functional polymorphisms of B7/CD28 co-signaling molecules alter susceptibility to colorectal cancer. PMID:25497975
  41. Studies suggest that CD28 T > C polymorphism (rs3116496) may have an increased risk of cancer in Asians. PMID:24927673
  42. These results suggest that HVEM might play more important roles than CD28 in ConA-mediated T cell proliferation PMID:24163161
  43. Results indicate that the CC genotype and C allele of PD.1.9 and TT genotype and the T allele of CD28 are genetic risk factors for development of a severe grade of GVHD. PMID:24564845
  44. these data identify CD28 as a novel receptor molecule that may contribute to amplify the inflammatory response in relapsing-remitting multiple sclerosis by favoring pro-inflammatory cytokine production and Th17 amplification PMID:24412596
  45. The results of our study suggest an association between IVS3 +17T/C polymorphism in the CD28 gene and acute kidney allograft rejection. PMID:24368148
  46. Increased circulating level of HSP60 and HSP70 might play a role in initiation and/or progression of atherosclerosis in CKD subjects through perturbation of CD4(+)CD28(null) cells. PMID:24347824
  47. Loss of CD28 expression by liver-infiltrating T cells contributes to pathogenesis of primary sclerosing cholangitis. PMID:24726754
  48. Investigation of organ sites, molecules, and cell subsets provides involvement in the priming of CD28 transgene-specific CD8 T cells following vaccination with a replication-deficient adenoviral vector. PMID:24951814
  49. this study identified two crucial immune-related molecules-CD28 and NFATc1, as putative targets of miR-145 in human and experimental myasthenia gravis PMID:24043548
  50. CD28 is an important mediator of Multiple myeloma survival during stress and can be targeted to overcome chemotherapy resistance. PMID:24782505

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface.
Tissue Specificity
Expressed in T-cells and plasma cells, but not in less mature B-cells.
Database Links

HGNC: 1653

UNIGENE: Hs.443123

KEGG: hsa:940

STRING: 9606.ENSP00000324890

OMIM: 186760

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products