Recombinant Human Sphingosine-1-phosphate lyase 1 (SGPL1)

Code: CSB-CF021197HU
Size:
20μg
20μg100μg
US$6745
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
SGPL1
Uniprot NO.
Alternative Names
SGPL1; KIAA1252; Sphingosine-1-phosphate lyase 1; S1PL; SP-lyase 1; SPL 1; hSPL; Sphingosine-1-phosphate aldolase
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-568
Target Protein Sequence
MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISADTHKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQMNGSPKPH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cleaves phosphorylated sphingoid bases (PSBs), such as sphingosine-1-phosphate, into fatty aldehydes and phosphoethanolamine. Elevates stress-induced ceramide production and apoptosis. Required for global lipid homeostasis in liver and cholesterol homeostasis in fibroblasts. Involved in the regulation of pro-inflammatory response and neutrophil trafficking. Modulates neuronal autophagy via phosphoethanolamine production which regulates accumulation of aggregate-prone proteins such as APP. Seems to play a role in establishing neuronal contact sites and axonal maintenance.
Gene References into Functions
  1. describe the sequential expression and localization of the endogenous S1P regulators SGPP-1 and SGPL-1 and highlight their contribution to the sphingolipid rheostat in inflammation. PMID:29375197
  2. Study verifies the role of a high-ranked gene in dysregulation of sphingolipid metabolism in the disease and demonstrate that inhibiting the enzyme, sphingosine-1-phosphate lyase 1 (SPL), has neuroprotective effects in Huntington's disease models. PMID:28931805
  3. Loss of SGPL1 function is associated with congenital nephrotic syndrome (CNS), adrenal calcifications, and hypogonadism. PMID:28181337
  4. results demonstrate that Sphingosine 1-phosphate lyase (SPL) is a host factor that augments type I IFN responses during influenza A virus infection; study delineates the relationship between IKKepsilon and SPL, which provides a mechanistic understanding of the pro-IFN activity of SPL PMID:28600291
  5. Mutations in sphingosine-1-phosphate lyase cause nephrosis with ichthyosis and adrenal insufficiency PMID:28165339
  6. Sphingosine-1-phosphate lyase mutations cause primary adrenal insufficiency and steroid-resistant nephrotic syndrome. PMID:28165343
  7. Overexpression of sphingosine-1-phosphate lyase 1 (SGPL1), reverse the interleukin-8 (IL-8) secretion enhancing effect of microRNA miR-125b in trophoblast cell line HTR8/SVneo cells. PMID:27935985
  8. Report a candidate gene (SGPL1) for autosomal recessive Charcot-Marie-Tooth disease with atypical disease course. Studies in patient-derived biosamples suggested that this phenotype is due to partial loss of SGPL1 function. Neuron-specific downregulation of the Drosophila orthologue impaired the morphology of the neuromuscular junction and caused progressive neurodegeneration PMID:28077491
  9. SPHK1:SGPL1 ratio correlated with increased cellular sphingosine-1-phosphate (S1P), and S1P correlated with drug resistance (IC50). PMID:26493335
  10. Results show that dissociation of SHP-1 from spinophilin is followed by an increase in the binding of spinophilin to PP1. PMID:25785436
  11. Sphingosine-1-phosphate lyase downregulation promotes colon carcinogenesis through STAT3-activated microRNAs. PMID:25347472
  12. S1P lyase - by facilitating S1P1 receptor recycling - is essential for S1P-mediated sustained signaling PMID:24704119
  13. results highlight the importance of S1P in AD suggesting the existence of a global deregulation of S1P signaling in this disease from its synthesis by SphK1 and degradation by SPL to its signaling by the S1P1 receptor. PMID:24468113
  14. The cells expressing SGPL1 in the parenchyma were CD68(+) APCs. PMID:24825162
  15. Data show that a easy assay for 2-hydroxyacyl-CoA lyase (HACL1) and sphingosine-1-phosphate lyase (SGPL1) activities was developed. PMID:24323699
  16. SPL expression and activity are downregulated in cancerous tissues, there is a relationship between loss of SPL expression and prostate cancer aggressiveness. PMID:22784711
  17. S1P(ext) mediated endothelial cell motility is dependent on intracellular S1P production, which is regulated, in part, by SphK1 and S1PL. PMID:21304987
  18. S1P lyase regulates DNA damage responses through a sphingolipid feedback mechanism. PMID:21368890
  19. high SPL transcription of H1155 cells was regulated by Sp1 and GATA-4/Sp1 complex formation, both of which bind to Sp1 sites of the 5'-SPL promoter. PMID:21184844
  20. Overexpression of sphingosine 1-phosphate lyase (SPL), which induces the degradation of sphingosine 1-phosphate, interfered with the amplification of infectious influenza virus. PMID:20519401
  21. sphingosine-1-phosphate lyase is a dual modulator of sphingosine 1-phosphate and ceramide metabolism as well as a regulator of cell fate decisions PMID:14570870
  22. genetic or epigenetic changes affecting intestinal sphingosine-1-phosphate metabolism may correlate with and potentially contribute to carcinogenesis PMID:17090686
  23. extracellular S1P is dephosphorylated and subsequently converted by cells, which appears to be important for clearance of the signaling molecule S1P in the local tissue environment after infections or injuries PMID:18172856
  24. Data suggest that lymphocyte trafficking is particularly sensitive to variations in sphingosine 1-phosphate lyase (S1PL) activity and suggest that there is a window in which partial inhibition of S1PL could produce therapeutic levels of immunosuppression. PMID:19119317

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type III membrane protein; Cytoplasmic side.
Protein Families
Group II decarboxylase family, Sphingosine-1-phosphate lyase subfamily
Tissue Specificity
Ubiquitously expressed. Expressed in fetal and adult adrenal gland (at protein level).
Database Links

HGNC: 10817

UNIGENE: Hs.499984

KEGG: hsa:8879

STRING: 9606.ENSP00000362298

OMIM: 603729

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products