MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ TSKL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization.
Gene References into Functions
Somatostatin receptor 5 variant (sst5TMD4) was expressed in a subset of breast cancers, where it correlated with angiogenic markers, lymphatic metastasis, and reduced disease-free survival.PMID:27507050
sst5TMD4 is overexpressed in PCa, especially in those patients with a worse prognosis, and plays an important pathophysiologic role in PCa, which suggesting its potential as a biomarker and/or therapeutic targetPMID:28705809
In cotransfected HEK-293 cells, SSTR5 and CB1R existed in a constitutive heteromeric complex under basal condition, which was disrupted upon agonist treatments. Furthermore, concurrent receptor activation led to preferential formation of SSTR5 homodimer and dissociation of CB1R homodimer.PMID:27984180
A truncated splice variant of the somatostatin receptor subtype 5, is associated to features of increased aggressiveness in pancreatic neuroendocrine tumors.PMID:26673010
SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume.PMID:25008035
This is the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior, suggesting that sst5TMD4 might play a functionally relevant role.PMID:25854304
A truncated sst5-variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analogues-therapy.PMID:25637790
SSTR5 protein is overexpressed in poorly differentiated thyroid cancer and may be involved in the lack of response to somatostatin analogue treatment.PMID:24465589
High SSTR5 expression is associated with gallbladder cancer.PMID:23991955
agonist-selective phosphorylation of carboxyl-terminal Threonine 333 of Sst5, is reported.PMID:23418396
Report down-regulation of SSTR-5 expression in operable hepatocellular carcinomas.PMID:22640914
Except for SSTR5, all SSTRs showed a tendency toward decreased expression in well-to poorly differentiated neuroendocrine carcinoma of the lung.PMID:22770972
Determination of the expression of SSTR5 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.PMID:22419713
The rabbit monoclonal antibodies UMB-4 and UMB-1 will facilitate the assessment of the somatostatin receptor status of human tumors during routine histopathological examinations.PMID:21952553
SSTR5 P335L is a hypofunctional protein with a potentially harmful effect on function, as well as potential latent effect, and therefore it could affect the clinical response to somatostatin analog therapy for patients with pancreatic cancer.PMID:21249361
Our results demonstrate a previously undetected strong association of two SSTR5 single nucleotide polymorphisms with acromegalyPMID:21810856
ZDHHC5 and SSTR5 are colocalized at the plasma membrane and coexpression of ZDHHC5 increased palmitoylation of SSTR5 whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it.PMID:21820437
differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of SSTR-5PMID:21383526
data suggest that SSTR5 genetic variants play a role in pancreatic cancer development and progressionPMID:21692047
demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation.PMID:21419811
The heterodimerization of somatostatin receptor-5 not only indicate the receptor's specificity of interaction but also provide new insight to understand the molecular mechanism in regulation of signaling pathway in receptor specific manner.PMID:21238583
These data indicate that the activation and/or overexpression of SST receptors along with the inhibition of EGFR will serve as an important therapeutic approach in the treatment of ErbB-positive tumors.PMID:21190959
Common genetic variation in the IGF1 and SSTR5 genes seems to influence circulating IGF-I levelsPMID:20810604
This study demonstrated negative immunoreactivity for SSTR-5 in the adenomatous tissue.PMID:19894022
importance of Asn13 and/or Asn26 residues in the agonist-specific signalling of hSSTR5PMID:20207824
Potential role of SSTR5 in the response of some tumors to somatostatin receptors.PMID:20233783
SSTR5 and CCR7 have a role in Crohn's disease pathogenesisPMID:20150960
identified an upstream promoter of the somatostatin receptor 5 gene with tissue-specific activityPMID:12072395
the SSTR5 gene is involved in the etiology of bipolar affective disorder or may exist in linkage disequilibrium with a susceptibility gene close to SSTR5.PMID:12192619
Results do not suggest the SSTR5 gene as a susceptibility gene for autismPMID:12898583
activation of hSSTR5 but not hSSTR1 is necessary for heterodimeric assemblyPMID:15247250
role for SSTR5 t-461c and c1004t alleles in influencing GH and IGF-I levels in patients with acromegaly, whereas SSTR2 and SSTR5 variants seem to have a minor role in determining the responsiveness to somatostatin analogsPMID:15914528
intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1PMID:16012170
Results suggest that the expression pattern of dopamine receptor 2 and somatostatin receptor 5 may influence the effects of SRIF analogs in growth hormone-secreting pituitary adenomas.PMID:16216913
The expression of SSTR5 in TSHoma may be a useful marker for predicting the outcome of octreotide therapy.PMID:17159301
The majority of all benign, premalignant and malignant laryngeal specimens expressed moderate to high levels of expression of SSTR5.PMID:18066572
Immunohistochemistry stufy of SSTR5 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm.PMID:18936524
SSTR5 mRNA levels in Cushing disease were greater than silent corticotroph adenoma (SCA) but did not differ between non-functioning pituitary tumor and SCA.PMID:19318729
investigation of the role of BBXXB and DRY motifs of SST5 in the transduction of intracellular signals involved in the regulation of GH secretion and cell proliferationPMID:19342453
The existence of two previously unidentified sst5 spliced variants with distinct distribution in normal tissues and pituitary tumors.PMID:19401364
Genetic variation in the SSTR5 gene and, particularly, the rs4988483 single nucleotide polymorphism influence circulating IGFI and IGFBP3 hormone levels with no measurable effect on prostate cancer risk.PMID:19423539
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary.