Home
Product
Protein
Transmembrane Proteins
Recombinant Human Somatostatin receptor type 4 (SSTR4)

Recombinant Human Somatostatin receptor type 4 (SSTR4)

Code: CSB-CF022727HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5398

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SSTR4

Uniprot NO.

P31391

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-388

Target Protein Sequence

MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM CPPLPCQQEALQPEPGRKRIPLTRTTTF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibits adenylyl cyclase. It is functionally coupled not only to inhibition of adenylate cyclase, but also to activation of both arachidonate release and mitogen-activated protein (MAP) kinase cascade. Mediates antiproliferative action of somatostatin in tumor cells.

Gene References into Functions

deregulated somatostatin signaling in the Alzheimer disease cortices studied cannot be explained by hypermethylation of the SST or SSTR4 promoter CpG islands. PMID:24602981
this study shows that CD26 is associated with SSTR4 in malignant pleural mesothelioma cells, and this interaction inhibits SSTR4-mediated cytostatic effects. PMID:24743707
High SSTR4 expression is associated with lymph node metastasis in gallbladder cancer. PMID:23991955
Evaluation of the potential use of sst5TMD4 expression in surgically removed pituitary adenomas as a predictor of the subsequent response of different pituitary tumors to somatostatin therapy. PMID:20233783
In somatotrophinomas patients treated with somatostatin analogs, the most expressed SSTR was SSTR5, SSTR3, SSTR2, SSTR1, and SSTR4, respectively. PMID:19330452
expression of SSTR4 transcripts up-regulated in prostatic carcinoma cells; SSTR4 agonists may have role in treatment of prostate cancer PMID:12210479
A variable degree of SSTR4 was detected in laryngeal benign, premalignant and malignant specimens, with the greatest percentage in teh malignant specimens. PMID:18066572
Immunohistochemistry stufy of SSTR4 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm. PMID:18936524
Heterodimerization between somatostatin receptor 4 and somatostatin receptor 5 exerted receptor and ligand specific changes in receptor coupling to adenylyl cyclase and the downstream signaling pathway. PMID:19426801
the expression, localization, and inflammation-induced alterations of sst(4) receptors in murine and human lungs PMID:19687471