MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLL GNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVM AVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVV FSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRV WAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVA LPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEE SREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase.
Gene References into Functions
the C-terminal phosphorylation motif of the human sst3 receptor that regulates its agonist-promoted phosphorylation, beta-arrestin recruitment, and internalization of this clinically relevant receptor, is reported.PMID:27101376
findings provide new insights in understanding the antiproliferative role of SSTR3 in breast tumor biology.PMID:26112183
In conclusions, in CNFAs, high expression of somatostatin receptors is much less common than that of D2RPMID:25536318
constitutive SSTR3 activity mediates transcriptional repression of GH.PMID:24606125
High SSTR3 expression is associated with gallbladder cancer.PMID:23991955
Determination of the expression of SSTR3 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas.PMID:22419713
mRNA levels of SSTR2a, SSTR3 and SSTR5 in neuroendocrine lung cancer affected patients, were determinedPMID:21503779
The cigarettes smoking and H. pylori infection are independent factors leading to decreasing of the SSTR3 mRNA level in gastric mucosa of patients with functional dyspepsia.PMID:20570798
There was a positive correlation between the percentage of tumor reduction by octreotide-lar and SSTR3 expression.PMID:19330452
expression of somatostatin (SS) and SS receptor (SSR) subtype 1 (sst1), sst2A, and sst3 in normal human thymic tissuePMID:12376335
localization and expression in human prostatic tissue and prostate cancer cell lines.PMID:12474541
Reduced SSTR3 expression is associated with gastric cancersPMID:15197339
Density of the SSTR3 receptor is decreased in gastric adenocarcinoma. H. pylori infection related reduction of the SSTR3 density in the antrum mucosa speaks for the need of eradication of these bacteria in the prevention of distal gastric cancer.PMID:17679363
Determine the influence of H. pylori infection and a family history of gastric cancer on the expression of SSTR3 in the gastric mucosa of non-cancer patients with dyspepsia.PMID:17683502
There was very little expression of SSTR3 in benign, premalignant, and cancerous laryngeal specimens; thus SSTR3 does not have an important role in laryngeal patholgy.PMID:18066572
Immunohistochemistry stufy of SSTR3 in prostate tissue from patients with bladder outlet obstruction showed that greatest proportion of basal cells showed a moderate intensity, strong immunoreactivity being observed only in 15.8% of cells.PMID:18936524
An interaction between the human somatostatin receptor 3 and the multiple PDZ protein MUPP1 was identified.PMID:19071123