MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.; Involved in cell adhesion and establishing epithelial cell polarity.
Gene References into Functions
Novel Single Nucleotide Polymorphism at ATP1B1 implicate gene regulatory dysfunction in QT prolongation in African and Hispanic Americans.PMID:27988371
the ratio between FXYD5 and alpha1-beta1 heterodimer determines whether the Na,K-ATPase acts as a positive or negative regulator of intercellular adhesion.PMID:27142834
Our study describes the potent inhibition of Chikungunya virus and related alphaviruses by the cardiac glycoside digoxin and demonstrates a function for the sodium-potassium ATPase in Chikungunya virus infection.PMID:27222471
Expression of miR-26a and miR-29a was significantly down regulated in leukoplakia and cancer tissues but up regulated in lichen planus tissues. Expression of target genes such as, ADAMTS7, ATP1B1, COL4A2, CPEB3, CDK6, DNMT3a and PI3KR1 was significantly down regulated in at least two of three disease types with respect to normal tissues.PMID:27515006
Overexpression of ATP1B1 is associated with cytogenetically normal acute myeloid leukemia.PMID:26506237
Na,K-ATPase b1-subunit is a target of the Shh signaling pathway and loss of b1-subunit expression may contribute to tumor development and progression not only in carcinoma but also in medulloblastoma, a tumor of neuronal origin.PMID:26286140
Impaired regulation and compromised activity of ion channel proteins contribute to the pathophysiology of vascular dementia.PMID:25152327
Activities of AE1 and the sodium pump are coregulated in kidney.PMID:25012180
ATP1B1 is epigenetically silenced by promoter methylation in both renal cell carcinoma (RCC) patients' tissues and cell lines.PMID:24452105
A polymorphic 3'UTR element in ATP1B1 regulates alternative polyadenylation and is associated with blood pressure.PMID:24098465
Changes were found in mRNA and protein expressions of Na(+)/K(+)-ATPase subunits in LG from term pregnant rabbits and these changes suggest a role in the pregnancy-related LG secretion changes and dry eye symptoms observed in these animals.PMID:23009595
Data show that protein kinase A (PKA) phosphorylation has a drastic impact on Na(+)/K(+)-ATPase (NKA) structure and dynamicsPMID:22433860
examined polymorphisms in three genes (ATP1B1, RGS5 and SELE) in relation to hypertension and blood pressure in a cohort of African-AmericansPMID:21881522
interactions between the beta subunits of neighboring cells maintain integrity of intercellular junctionsPMID:21642423
Na(+)-K(+) ATPase B1 can synergize with adriamycin and reverse drug resistance in MCF7 cells.PMID:19664334
Silencing of ATP1B1 gene can enhance the proliferation and migration capability of SGC-7901 adenocarcinoma cells.PMID:19619434
through its interaction with ATP1B1, MLC1 is involved in the control of intracellular osmotic conditions and volume regulation in astrocytes, opening new perspectives for understanding the pathological mechanisms of MLC disease.PMID:20926452
Data indicate that CypB through its interaction with Na/K-beta1 might regulate maturation and trafficking of the pump through the secretory pathway.PMID:21085665
Results identified that the beta1 subunit of the host Na(+)/K(+)-ATPase beta1 subunit (ATP1B1) interacts with the cytoplasmic domain of both the influenza A and B virus M2 and BM2 proteins.PMID:21104370
Data show that deglycosylation in polarized hepatic cells by drugs, or by site-directed mutagenesis of the N-linked-glycosylation residues, cause the Na+/K+-ATPase beta-subunit to traffic from the native basolateral to the apical/canalicular domain.PMID:16339171
these studies are indicative of a synergism between Sp1 and CREB in mediating regulation of Na-K ATPase beta1 subunit by PGRE3; while regulation occurring through PGRE1 also involves Sp1 and CREB.PMID:16478973
Study identifies an interaction between Wolframin and Na+/K+ ATPase beta1 subunit in transfected Cos7 cells, and between endogenous proteins in placental, neuroblastoma and MIN6 pancreatic beta-cell lines.PMID:17947299
E2A and Na/K-ATPase beta1 subunit expression in epithelial cells are regulated by interactions between these proteins.PMID:18727914
Reduced expression of the Na,K-beta(1) protein is associated with oxaliplatin resistance in cancer cells.PMID:19322565
Propose that kinase-dependent regulation of the Na(+)-K(+) pump occurs via glutathionylation of its beta(1) subunit (ATP1B1) at Cys46.PMID:19542013
ATP1B1 may confer susceptibility to BP regulation and hypertension in this Chinese population.PMID:19563793
Measured properties of the purified carboxy-terminal lobe suggest that the fragment is correctly folded and compatible with the proposed model of Na,K-ATPase beta1 subunit.PMID:19694409
Genome-wide association study of gene-disease association. (HuGE Navigator)PMID:19305409
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.