RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGA TSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLC QATRGPCAIVERERGWPDFLRCTPDRFPEGCTNEVQNIKFNSSGQCEVPLVRTDNPKSWY EDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVIL FYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMA GVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVS GICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINE TMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDC EIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDEPKRIKKSK MIAKAFSKRHELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVA RRGAILPQDISVTPVATPVPPEEQANLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAP PPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAWTLVSNPFCPEPSPPQDP FLPSAPAPVAWAHGRRQGLGPIHSRTNLMDTELMDADSDF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
G protein-coupled receptor that probably associates with the patched protein (PTCH) to transduce the hedgehog's proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7, GLI2 and GLI3 in the cilia. Interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip for GLI2 activation.
Gene References into Functions
Study present the crystal structure of the multi-domain human SMO in complex with a specially designed seven-transmembrane helices domain (TMD) ligand, shedding light on interactions between the cysteine-rich domain and TMD. Combining the structures with biophysical characterization and computer modelling results, study propose a mechanistic model of SMO activation.PMID:28513578
Case Report: Happle-Tinschert Syndrome is caused by mosaic SMO mutations and represents a variant of Curry-Jones syndrome.PMID:29335739
cholesterol within the bilayer is sufficient for constitutive Smoothened activation. Cholesterol effects occur independently of the lipid-binding Smoothened extracellular domain, a region that is dispensable for Patched1-Smoothened coupling.PMID:29229834
A somatic mutation in SMO likely accounts for the structural malformations and predisposition to form bowel hamartomas and myofibromas. The mutation burden in the involved tissues likely accounts for the variable manifestationsPMID:28386950
Dual MET and SMO Inhibitors are potent antiproliferative agents in EGFR-Tyrosine kinase inhibitors resistant human non small cell lung cancer.PMID:28787156
Smoothened-antagonists reverse alterations in Hedgehog signaling and chondrocyte primary cilium length in homogentisic acid induced model of alkaptonuria.PMID:28019670
SMO mutation is associated with olfactory groove meningiomas.PMID:28082415
SMO is covalently modified by cholesterol. This modification is regulated by Ptch1 and Hh and is essential for Hh signaling.PMID:28344083
A screen for analogs revealed another six molecules, with IC50 values in the low micromolar range. Importantly, one of the most active of the new antagonists continued to be efficacious at the D473H mutant of Smoothened, which confers clinical resistance to the antagonist vismodegib in cancer treatment.PMID:27490099
Our studies demonstrate an important role for smoothened and glioma-associated oncogene homology-1 in gastric cancer and suggest inhibition of hedgehog pathway as a novel and potent strategy to treat gastric cancer patientsPMID:28675107
The results suggest that Shh signaling plays an important role in rheumatoid arthritis-Fibroblast-like synoviocytes proliferation in a Smo-dependent manner.PMID:26189371
Mutations in SMO gene is associated with Curry-Jones Syndrome.PMID:27236920
The Hedgehog pathway receptor SMO is an important regulator of gastric cancer paclitaxel resistance.PMID:28350784
Role of SMO-mediated Hedgehog signaling pathway in the proliferation and apoptosis of multiple myeloma cellsPMID:27959416
exogenous addition of 3beta,5alpha-dihydroxycholest-7-en-6-one, a naturally occurring B-ring oxysterol derived from 7-DHC that also accumulates in Smith-Lemli-Opitz syndrome, blocked Hedgehog signaling by inhibiting activation of the essential transduction component Smoothened, through a mechanism distinct from Smoothened modulation by other lipids.PMID:27162362
High SMO expression is associated with pancreatic and skin cancers.PMID:26784250
crystal structures of the Hh signal transducer and oncoprotein Smoothened, a GPCR that contains two distinct ligand-binding sites: one in its transmembrane domain and one in the cysteine-rich domainPMID:27437577
Smoothened determines beta-arrestin-mediated removal of the G protein-coupled receptor Gpr161 from the primary cilium.PMID:27002170
The combined inhibition of SMO and EGFR exerted a strong antiproliferative activity.PMID:26124204
Suggest that hypoxia promotes SMO transcription through upregulation of MAML3 and RBPJ to induce proliferation, invasiveness and tumorigenesis in pancreatic cancer.PMID:26655998
These findings suggest that miR-218 inhibits multidrug resistance of gastric cancer cells by down-regulating smoothened expression.PMID:26261515
Recipient SMO rs3824 polymorphism is associated with an increased risk of hepatocellular carcinoma recurrence following orthotopic liver transplantation.PMID:25944162
Strikingly, in basal cell carcinoma patients treated with Smo inhibitor, squamous cell cancers with RAS/MAPK activation emerged from the antecedent basal cell carcinoma tumors.PMID:26130651
report discussed two different SMO mutations representing examples of primary or secondary resistance respectively to vismodegib in two distinct basal cell carcinoma casesPMID:25306392
The SMOF412E mutation was not detected in ameloblastoma. The BRAFV600E-activating mutation is a common event in ameloblastomas, occurring regardless of site or histological type. This mutation is also detected in odontogenic carcinomas.PMID:25854168
SMO was upregulated in gliomas and was associated with tumor grade and survival period. SMO inhibition suppressed the biological behaviors of glioma cells. SMO expression was inversely correlated with miR-326 and is a novel direct target of miR-326.PMID:25173582
SMO expression was significantly associated with better colorectal cancer-specific survival.PMID:25023548
The Smoothened receptor (SMO) mediates signal transduction in the hedgehog pathway, which is implicated in normal development and carcinogenesis.PMID:25008467
analysis of small-molecule regulation of SMO and discussion of potential mechanisms for its endogenous regulation [review]PMID:25785427
SMO mutations are implicated in drug resistance in basal cell carcinoma.PMID:25759019
Mutations within the SMO protein are implicated in drug resistance in basal cell carcinoma.PMID:25759020
Studies indicate that Smoothened (Smo) inhibitor was beneficial for the treatment of advanced basal cell carcinoma (BCC).PMID:24469022
signaling mediated by Smo contributes to acquired chemoresistance through activating the transcriptional factor GliPMID:24393163
SMO mutation is asociated with ameloblastoma.PMID:24859340
MicroRNA-338-3p could inhibit colorectal carcinoma cell invasion and migration by inhibiting smoothened expression.PMID:24277750
The structure of the Smo receptor will promote the development of small molecules interacting with a key therapeutic target with interests in regenerative medicine and cancer.[review]PMID:24148123
miR-338-3p could suppress colorectal carcinoma growth by inhibiting SMO protein expression.PMID:23599646
We observed strong correlation between higher SMO and SHH expression levels with poorer overall survival.PMID:23379358
Smo antagonism led to reduced Hedgehog pathway activity, resulting in decreased cell proliferation and induction of apoptosis via the intrinsic pathway in the esophageal cancer cellsPMID:23915072
GSA-10 allows the pharmacological characterization of a novel Smo active site.PMID:23448715
downregulation of miR-326 may be a possible mechanism for unrestricted activation of Smo signal transducer of the oncogenic Hedgehog pathway in chronic myeloid leukemiaPMID:23341351
Nonclassical activation of Hedgehog signaling enhances multidrug resistance and makes cancer cells refractory to Smoothened-targeting Hedgehog inhibitionPMID:23508962
crystal structure of the transmembrane domain of the human SMO receptor bound to the small-molecule antagonist LY2940680 at 2.5 A resolutionPMID:23636324
A subset of meningiomas lacking NF2 alterations harbored recurrent oncogenic mutations in AKT1 (p.Glu17Lys) and SMO (p.Trp535Leu) and exhibited immunohistochemical evidence of activation of these pathways.PMID:23334667
High SMO expression is asociated with postoperative liver metastasis in colon cancer.PMID:23098507
SMO mutations, which activate Hedgehog signaling, were identified in ~5% of non-NF2 mutant meningiomasPMID:23348505
High SMO expression is associated with colorectal cancer.PMID:22901214
Study shows that hedgehog signaling rewires cellular metabolism; Smo-dependent noncanonical signal rewires metabolism in vitro and in vivo.PMID:23063129
different pools of Smo move into cilia through distinct mechanismsPMID:22864913
the effects of oxysterols on Hedgehog signaling are exquisitely stereoselective, consistent with the hypothesis that they function through a specific protein target.PMID:22231273