AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSI LAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT QSQLAVQIRRGRETLTLYVTPEVTE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Cleaves THAP5 and promotes its degradation during apoptosis. Isoform 2 seems to be proteolytically inactive.
Gene References into Functions
The association between the change in HtrA2 and proteins associated with LATS1 in ovarian serous cancer cell lines after repeated treatment with cisplatin was evaluated in vitro. In immunohistochemical analysis, repeated cisplatin treatment induced downregulation of HtrA2 protein expression, before and after cisplatin-based chemotherapy in SAC.PMID:29168038
STEMI patients with elevated circulating HtrA2 levels were identified as having ischemia-reperfusion injury.PMID:28602551
The important functions for HTRA2 in programmed cell death.PMID:27696117
A pathogenic role of serine protease HtrA2 in Parkinson's and Alzheimer's diseases has been described. (Review)PMID:26965693
The first report of recessive deleterious mutations in HTRA2 in human. Absence of HTRA2/Omi is associated with severe neurodegenerative disorder of infancy, abnormal mitochondria, 3-methylglutaconic aciduria and increased sensitivity to apoptosis.PMID:27208207
HTRA2 and ANO3 mutations are not common causes of essential tremorPMID:27881096
HtrA2 under stress conditions induces vimentin cleavage in wild-type and SH-SY5Y cells transfected with ABP with the Alzheimer disease-associated Swedish mutation. Interplay between Omi/HtrA2 and vimentin affects mitochondrial distribution in neurons.PMID:25288153
The a5 helix of PDZ was involved in both, the intra- and intersubunit changes of interactions and thus seems to play an important role in HtrA2 activation.PMID:26702898
study examined the association of HTRA2 p.G399S mutation with essential tremor(ET) and Parkinson disease (PD) in Asians and found that HTRA2 p.G399S is rare and does not appear to play a major role in subjects with coexistent ET and PD nor in those with pure ET or PD phenotypePMID:25791756
The NG2 proteoglycan protects oligodendrocyte precursor cells against oxidative stress via interaction with OMI/HtrA2.PMID:26340347
Omi/HtrA2 overexpression promotes hepatocellular carcinoma cell apoptosis and the ped/pea-15 expression level causes this difference of the Omi/HtrA2 pro-apoptotic marker in the various hepatocellular carcinoma cell linesPMID:25484138
HtrA2 might promote the apoptosis of non-small cell lung cancer cells, and serve as a target for NSCLC's treatment.PMID:25086674
Our findings indicate that radiation-inducible gene therapy may have potential to be a more effective and specific therapy for uveal melanoma because the therapeutic gene can be spatially or temporally controlled by exogenous radiation.PMID:24606398
HtrA2 expression was a predictor for sensitivity to chemotherapy, and could be a candidate of molecular target in the treatment of high-grade serous ovarian cancers.PMID:25628093
results suggest that in some families, HTRA2 p.G399S is responsible for hereditary essential tremor and that homozygotes for this allele develop Parkinson diseasePMID:25422467
This study shows that PARK13 and PINK1 are subcellular-specific, but dynamic, proteins with a reciprocal molecular relationship.PMID:24798695
Rate of HTRA2 sequence variants in Taiwanese Parkinson's disease (PD) is very low; although the HTRA2 R36W variant may contribute to the PD risk in some cases, HTRA2 is not playing a major role in PD pathogenicityPMID:24337630
demonstrate a novel N-terminal ligand-mediated triggering of an allosteric switch essential for transforming HtrA2 to a proteolytically competent state in a PDZ-independent yet synergistic activation processPMID:24698088
downregulation of Omi/HtrA2 may contribute to the potent anti-atherosclerotic effect of shear stress by preventing endothelial cells from entering apoptosis.PMID:23123883
The proteases HtrA2 and UCHL1 regulate TNF-induced necroptosis.PMID:24090154
Findings indicate the importance of N-terminal region, oligomerization, and intricate intermolecular PDZ-protease interaction in proper active-site formation, enzyme-substrate complex stabilization, and hence HtrA2 functions.PMID:23608143
HTRA2-regulated protein quality control in the intermembrane space of mitochondria is important for the maintenance of mitochondrial homeostasisPMID:23242108
platelets have a functional intrinsic apoptotic-signalling pathway including the pro-apoptotic protease Omi/HtrA2 and its target protein XIAPPMID:23306356
Results demonstrate that HtrA2 deficiency causes mtDNA damage through ROS generation and mutation, which may lead to mitochondrial dysfunction and consequent triggering of cell death in aging cells.PMID:23542127
These studies identified a novel non-canonical selective binding pocket in HtrA2 which initiates signal propagation to the distal active site through a complex allosteric mechanism.PMID:23457469
Hepatocellular carcinoma cells may need Omi/HtrA2 expression for apoptosis and Omi/HtrA2 might be an important prognostic marker for primary hepatocellular carcinoma.PMID:23682386
Omi/HtrA2 expression is inversely correlated with HIF-1alpha expression in hepatocellular carcinoma.PMID:22490291
Identification of a novel anti-apoptotic E3 ubiquitin ligase that ubiquitinates antagonists of inhibitor of apoptosis proteins SMAC, HtrA2, and ARTS.PMID:23479728
these results demonstrated that HIF-1alpha suppressed hepatocellular carcinoma cell apoptosis through inhibiting Omi/HtrA2 expression and upregulating Bcl-2 expression to impede Omi/ HtrA2 releasing from the mitochondrionPMID:23581228
HtrA2 deficiency in non-neuronal tissues does not cause early lethality, but leads to increased accumulation of mtDNA deletions and premature aging.PMID:22976834
study found that the levels of HtrA2 and HtrA3-S were higher in thyroid malignant tumors compared to normal tissues and benign tumorsPMID:22923201
At a low MOI (</=0.01), cytomegalovirus-associated programmed cell death terminates productive infection via a pathway triggered by the mitochondrial serine protease HtrA2/Omi.PMID:23159167
HtrA2/Omi exerts a protective function in 6-OHDA-induced cell death by regulating endoplasmic reticulum stress-related proteins.PMID:22246992
Low expression of HtrA2 and high expression of WT1 are closely related with occurrence and development of acute leukemia.PMID:22391154
HtrA2/Omi, which normally exists in the mitochondria, can cause Matrix metalloproteinase-3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cellsPMID:22265821
Melatonin inhibited Bax expression and the release of the omi/HtrA2 into the cytoplasm induced by 1 muM rotenone.PMID:21883444
HtrA2 and Cdk5 interact in human and mouse cell lines and brain.PMID:21701498
In patients of Chinese origin diagnosed with Parkinson's disease (PD), novel variations Of HTRA2 are found: the IVS5+29T>A variant may be a risk factor for PD (P<0.05), while the c.G77A variant might be a pathogenic mutation.PMID:21338583
The percentage of mitochondrial dysfunction and apoptosis in cells carrying the HTRA2 Pro143Ala variant was significantly higher than wild-type cells.PMID:21701785
These findings suggest that the HtrA2-mediated cleavage of UCH-L1 may play important roles in regulating the fine balance between cell growth and cell death.PMID:22001920
Syk drives EBV+ B cell lymphoma survival through PI3K/Akt activation, which prevents the HtrA2-dependent loss of XIAP. Syk, Akt, and XIAP antagonists may present potential new therapeutic strategies for PTLDPMID:21908615
Upon IMS stress, overproduction of reactive oxygen species (ROS) and phosphorylation of AKT triggers estrogen receptor (ER) activity, which further upregulates the transcription of the mitochondrial regulator NRF1 and the IMS protease HTRA2.PMID:21486948
In the cerebral cortex and hippocampus from patients with Alzheimer's disease, densely accumulated HtrA2/Omi immunoreactivity is scattered, both intracellularly and extracellularly.PMID:20938363
HtrA2 was weakly expressed in small lymphocytic lymphoma and in diffuse large b-cell lymphoma.PMID:21732781
This largest association study performed revealed no overall strong association of Omi/HtrA2 variants with Parkinson dusease in populations worldwide.PMID:20036034
The protective effect of melatonin is likely mediated, in part, by inhibition of peroxynitrate-mediated nitrosative stress, which in turn relieves imbalance of mitochondrial HtrA2-PED signaling and endothelial cell death.PMID:21198825
we analyzed the occurrence of the OMI/HTRA2 variants A141S and G399S in Swedish case-control materials for AD and PD and found a weak association of A141S with Alzheimer's disease, but not with Parkinson's disease.PMID:21163861
Omi/HtrA2 expression is associated with tumor differentiation, extent of lymph node metastasis, and tumor stage of gastric carcinoma.PMID:20972909
Integrin alpha 7 interacts with high temperature requirement A2 (HtrA2) to induce prostate cancer cell deathPMID:20651226
abnormal accumulations of HtrA2/Omi may occur in several types of motor neuronal inclusions in the anterior horn from sporadic ALS and SOD1-linked familial ALS cases, and that HtrA2/Omi may be associated with the pathogenesis of both types of ALSPMID:20202124
Show
More
Hide
All
Subcellular Location
Mitochondrion intermembrane space. Mitochondrion membrane; Single-pass membrane protein. Note=Predominantly present in the intermembrane space. Released into the cytosol following apoptotic stimuli, such as UV treatment, and stimulation of mitochondria with caspase-8 truncated BID/tBID.
Protein Families
Peptidase S1C family
Tissue Specificity
Isoform 1 is ubiquitous. Isoform 2 is expressed predominantly in the kidney, colon and thyroid.