Recombinant Human STEAP1 protein (STEAP1)

In Stock
Code: CSB-CF890691HUm3
Size:
20ug
20ug100ug
US$1040
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: C-terminal Twin-Strep-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human STEAP1 protein
Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
STEAP1
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-339aa
Target Protein Sequence
MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Full Length
Tag Info
C-terminal Twin-Strep-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Gene References into Functions
  1. High STEAP1 expression is associated with prostate cancer. PMID:29464393
  2. Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression. PMID:27792302
  3. These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression PMID:25453051
  4. Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID:24239460
  5. The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID:24025158
  6. STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID:23060075
  7. A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID:22317770
  8. STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1. PMID:22080479
  9. STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID:22317770
  10. EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID:22080479
  11. Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP. PMID:19915386
  12. Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID:15958640
  13. STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID:18793824
  14. STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID:18958632
  15. STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice. PMID:19196137

Show More

Hide All

Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.
Database Links

HGNC: 11378

UNIGENE: Hs.61635

KEGG: hsa:26872

STRING: 9606.ENSP00000297205

OMIM: 604415

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products