Recombinant Human SARS coronavirus Protein 7a (7a)

CSB-CF348675HQE
Size:
20μg
20μg100μg
US$3295
Quantity:
Express system: in vitro E.coli expression system
Species: Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Target Names
7a
Uniprot NO.
Species
Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)
Source
in vitro E.coli expression system
Expression Region
16-122
Target Protein Sequence
ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Description

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Plays a role as antagonist of host tetherin (BST2), disrupting its antiviral effect. Acts by binding to BST2 thereby interfering with its glycosylation. May suppress small interfering RNA (siRNA). May bind to host ITGAL, thereby playing a role in attachment or modulation of leukocytes.
Gene References into Functions
  1. 7a accessory protein suppressed both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA PMID:20631126
  2. In this study the authors present data demonstrating that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17). PMID:20144233
  3. overexpression of 7a induces apoptosis via a caspase-dependent pathway in cell lines derived from different organs, including lung, kidney, and liver. PMID:15564512
  4. Protein 7a expression was associated with blockage of cell cycle progression at G0/G1 phase in HEK 293 cells, COS-7, and Vero cells via cyclin D3 and rb protein pathways. PMID:16303160
  5. analysis of SARS-CoV accessory proteins 7a and 7b PMID:17037516
  6. severe acute respiratory syndrome coronavirus 7a protein induction of apoptosis is dependent on its interaction with the Bcl-XL protein PMID:17428862

Show More

Hide All

Subcellular Location
Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.
Database Links

KEGG: vg:1489674

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products