Home
Product
Protein
Transmembrane Proteins
Recombinant Human SARS coronavirus Protein 7a (7a)

Recombinant Human SARS coronavirus Protein 7a (7a)

Code: CSB-CF348675HQE

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3295

Quantity:

Express system: in vitro E.coli expression system

Species: Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Uniprot NO.

P59635

Species

Human SARS coronavirus (SARS-CoV) (Severe acute respiratory syndrome coronavirus)

Source

in vitro E.coli expression system

Expression Region

16-122

Target Protein Sequence

ELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTY QLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays a role as antagonist of host tetherin (BST2), disrupting its antiviral effect. Acts by binding to BST2 thereby interfering with its glycosylation. May suppress small interfering RNA (siRNA). May bind to host ITGAL, thereby playing a role in attachment or modulation of leukocytes.

Gene References into Functions

7a accessory protein suppressed both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA PMID:20631126
In this study the authors present data demonstrating that the SARS-CoV 7a protein interacts with human Ap4A-hydrolase (asymmetrical diadenosine tetraphosphate hydrolase, EC 3.6.1.17). PMID:20144233
overexpression of 7a induces apoptosis via a caspase-dependent pathway in cell lines derived from different organs, including lung, kidney, and liver. PMID:15564512
Protein 7a expression was associated with blockage of cell cycle progression at G0/G1 phase in HEK 293 cells, COS-7, and Vero cells via cyclin D3 and rb protein pathways. PMID:16303160
analysis of SARS-CoV accessory proteins 7a and 7b PMID:17037516
severe acute respiratory syndrome coronavirus 7a protein induction of apoptosis is dependent on its interaction with the Bcl-XL protein PMID:17428862

Hide All

Subcellular Location

Virion. Host endoplasmic reticulum membrane; Single-pass membrane protein. Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein. Host Golgi apparatus membrane; Single-pass membrane protein.

Database Links

KEGG: vg:1489674

Promotions