Recombinant Human Reticulon-1 (RTN1)

Code: CSB-CF619090HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$8301

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

RTN1

Uniprot NO.

Q16799

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-776

Target Protein Sequence

MAAPGDPQDELLPLAGPGSQWLRHRGEGENEAVTPKGATPAPQAGEPSPGLGARAREAAS REAGSGPARQSPVAMETASTGVAGVSSAMDHTFSTTSKDGEGSCYTSLISDICYPPQEDS TYFTGILQKENGHVTISESPEELGTPGPSLPDVPGIESRGLFSSDSGIEMTPAESTEVNK ILADPLDQMKAEAYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPD KPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPVKITLTEIEPSVETTTQEKT PEKQDICLKPSPDTVPTVTVSEPEDDSPGSITPPSSGTEPSAAESQGKGSISEDELITAI KEAKGLSYETAENPRPVGQLADRPEVKARSGPPTIPSPLDHEASSAESGDSEIELVSEDP MAAEDALPSGYVSFGHVGGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEES PKREQDSPPMKPSALDAIREETGVRAEERAPSRRGLAEPGSFLDYPSTEPQPGPELPPGD GALEPETPMLPRKPEEDSSSNQSPAATKGPGPLGPGAPPPLLFLNKQKAIDLLYWRDIKQ TGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKAY LELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFN GLTLLLMAVVSMFTLPVVYVKHQAQIDQYLGLVRTHINAVVAKIQAKIPGAKRHAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Inhibits amyloid precursor protein processing, probably by blocking BACE1 activity.

Gene References into Functions

Data suggest that reticulon 1A (RTN1A) functions not only as an endoplasmic reticulum-shaping protein but also as a protein that promotes contacts between endoplasmic reticulum and mitochondria. PMID:28760823
Results suggest evidence of genetic association between common variants in RTN1 and end-stage kidney disease in African-Americans and European-Americans. PMID:26496126
RTN1A is a key mediator for proteinuria-induced tubular cell toxicity and renal fibrosis. PMID:26739891
RTN1A contributes to progression of kidney disease by inducing ER stress. PMID:26227493
MANF is a protein that interacts with RTN1-C PMID:25543119
RTN-1C involvement in the regulation of Endoplasmic reticulum-mitochondria cross-talk, defines a role for RTN-1C in maintaining the function of contacts between the two organelles. PMID:25573430
RTN1-C induces PDI redistribution in endoplasmic reticulum vesicles, and concomitantly modulates its activity by decreasing the levels of its S-nitrosylated form. PMID:23559015
In the present study a potential metal ion binding motif (HxE/D) at the C-terminal of the RTN1-C has been identified and its capability to bind metals investigated by UV-vis, CD, multidimensional NMR spectroscopy and biological assays. PMID:22522967
RTN-1C is able to specifically regulate gene expression, modulating transcript clusters which have been implicated in the onset of neurodegenerative disorders PMID:20708685
RTN1-A and RTN1-B share N-terminal 168 amino acid region, suggesting that the 168 amino acid region might play a role in regulating the endocytic process PMID:14995077
Data demonstrate that reticulon 1 interacts specifically with spastin. PMID:16602018
analyzed the endoplasmic reticulum (ER) localization signal of human RTN1-A. Mutant proteins lacking the first (39 residues) or second (36 residues) hydrophobic segment showed ER localization PMID:17303085
These data indicate that RTN-1C is able to modulate the cellular sensitivity to different apoptotic pathways representing a promising molecular target for new drug development. PMID:17596210
Nucleic acid binding of the RTN1-C C terminal region is reported with a view towards the functional role of a reticulon protein. PMID:19140693
RTN-1C protein binds to DNA and that its biological function is regulated by acetylation and is coupled to the inhibition of HDAC activity. PMID:19668229

Hide All

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Tissue Specificity

Expressed in neural and neuroendocrine tissues and cell cultures derived therefrom. Expression of isoform RTN1-C is strongly correlated with neuronal differentiation.

Database Links

HGNC: 10467

UNIGENE: Hs.368626

KEGG: hsa:6252

STRING: 9606.ENSP00000267484

OMIM: 600865

Promotions