Recombinant Human Relaxin-3 receptor 1 (RXFP3)

Code: CSB-CF873646HU
Size:
20μg
20μg100μg
US$6004
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
RXFP3
Uniprot NO.
Alternative Names
RXFP3; GPCR135; RLN3R1; SALPR; Relaxin-3 receptor 1; RLN3 receptor 1; G protein-coupled receptor SALPR; G-protein coupled receptor GPCR135; Relaxin family peptide receptor 3; Somatostatin- and angiotensin-like peptide receptor
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-469
Target Protein Sequence
MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation.
Gene References into Functions
  1. This study indicated that RXFP3 mainly localised in the post-acrosomal region of sperm head and neck. PMID:29159832
  2. The role of these four INSL5 determinants in distinguishing RXFP4 from RXFP3. PMID:27404393
  3. Therefore, we conclude that stapling of the relaxin3 B chain does not compromise its ability to activate RXFP3 and is a promising method for developing stable peptide agonists and antagonists of RXFP3 to aid relaxin-3/RXFP3 research. PMID:27498038
  4. the negatively charged transmembrane aspartate residue controls activation of the relaxin-3 receptor RXFP3 PMID:27353281
  5. we demonstrated distinct patterns of signalling for H3 and H2 relaxin and R3(BDelta23-27)R/I5 at the RXFP3 receptor PMID:24641548
  6. Glu141 and Asp145 of the RXFP3 interact with the highly conserved arginine residues of relaxin-3. PMID:24615237
  7. demonstrate the existence of an allosteric site for modulation of RXFP3 PMID:22347403
  8. H3 relaxin potently activates all signaling pathways coupled to RXFP3, whereas H2 relaxin is an AP-1-biased ligand relative to H3 relaxin. PMID:20159943
  9. GPCR135 (SALPR) is the receptor for relaxin-3 PMID:14522968
  10. Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142. PMID:15465925
  11. functional response to H3 relaxin and other relaxin/insulin peptides of GPCR135 expressed in CHO-K1 cells was measured in the cytosensor microphysiometer and analyzed using inhibitors of signal transduction proteins PMID:15956730
  12. analysis of truncated human relaxin-2 and -3 (H2 and H3) relaxin peptides and their binding and cAMP activities on RXFP1, RXFP2, and RXFP3 PMID:18434306
  13. the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation. PMID:18582868
  14. Results decribe the structural and functional aspects of the interaction between relaxin-3 and its receptor, RXFP3. PMID:19152634

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed predominantly in brain regions. Highest expression in substantia nigra and pituitary, followed by hippocampus, spinal cord, amygdala, caudate nucleus and corpus callosum, quite low level in cerebellum. In peripheral tissues, relatively high leve
Database Links

HGNC: 24883

UNIGENE: Hs.170146

KEGG: hsa:51289

STRING: 9606.ENSP00000328708

OMIM: 609445

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products