Recombinant Human Relaxin-3 receptor 1 (RXFP3)

Code: CSB-CF873646HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6004

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

RXFP3

Uniprot NO.

Q9NSD7

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-469

Target Protein Sequence

MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWWELGLELPDGA PPGHPPGSGGAESADTEARVRILISVVYWVVCALGLAGNLLVLYLMKSMQGWRKSSINLF VTNLALTDFQFVLTLPFWAVENALDFKWPFGKAMCKIVSMVTSMNMYASVFFLTAMSVTR YHSVASALKSHRTRGHGRGDCCGRSLGDSCCFSAKALCVWIWALAALASLPSAIFSTTVK VMGEELCLVRFPDKLLGRDRQFWLGLYHSQKVLLGFVLPLGIIILCYLLLVRFIADRRAA GTKGGAAVAGGRPTGASARRLSKVTKSVTIVVLSFFLCWLPNQALTTWSILIKFNAVPFS QEYFLCQVYAFPVSVCLAHSNSCLNPVLYCLVRREFRKALKSLLWRIASPSITSMRPFTA TTKPEHEDQGLQAPAPPHAAAEPDLLYYPPGVVVYSGGRYDLLPSSSAY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for RNL3/relaxin-3. Binding of the ligand inhibit cAMP accumulation.

Gene References into Functions

This study indicated that RXFP3 mainly localised in the post-acrosomal region of sperm head and neck. PMID:29159832
The role of these four INSL5 determinants in distinguishing RXFP4 from RXFP3. PMID:27404393
Therefore, we conclude that stapling of the relaxin3 B chain does not compromise its ability to activate RXFP3 and is a promising method for developing stable peptide agonists and antagonists of RXFP3 to aid relaxin-3/RXFP3 research. PMID:27498038
the negatively charged transmembrane aspartate residue controls activation of the relaxin-3 receptor RXFP3 PMID:27353281
we demonstrated distinct patterns of signalling for H3 and H2 relaxin and R3(BDelta23-27)R/I5 at the RXFP3 receptor PMID:24641548
Glu141 and Asp145 of the RXFP3 interact with the highly conserved arginine residues of relaxin-3. PMID:24615237
demonstrate the existence of an allosteric site for modulation of RXFP3 PMID:22347403
H3 relaxin potently activates all signaling pathways coupled to RXFP3, whereas H2 relaxin is an AP-1-biased ligand relative to H3 relaxin. PMID:20159943
GPCR135 (SALPR) is the receptor for relaxin-3 PMID:14522968
Substitution of the relaxin-3 A-chain with the A-chain from insulin-like peptide 5 results in a chimeric peptide that selectively activates GPCR135 and GPCR142. PMID:15465925
functional response to H3 relaxin and other relaxin/insulin peptides of GPCR135 expressed in CHO-K1 cells was measured in the cytosensor microphysiometer and analyzed using inhibitors of signal transduction proteins PMID:15956730
analysis of truncated human relaxin-2 and -3 (H2 and H3) relaxin peptides and their binding and cAMP activities on RXFP1, RXFP2, and RXFP3 PMID:18434306
the N-terminus and EL2 domains of RXFP3 and RXFP4 are involved in ligand binding while TM2, 3, and 5 are critical for receptor activation. PMID:18582868
Results decribe the structural and functional aspects of the interaction between relaxin-3 and its receptor, RXFP3. PMID:19152634

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed predominantly in brain regions. Highest expression in substantia nigra and pituitary, followed by hippocampus, spinal cord, amygdala, caudate nucleus and corpus callosum, quite low level in cerebellum. In peripheral tissues, relatively high leve

Database Links

HGNC: 24883

UNIGENE: Hs.170146

KEGG: hsa:51289

STRING: 9606.ENSP00000328708

OMIM: 609445

Promotions