CQEANYGALLRELCLTQFQVDMEAVGETLWCDWGRTIRSYRELADCTWHMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISGRAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for calcitonin-gene-related peptide (CGRP) together with CALCRL.
Gene References into Functions
T-A-T RAMP1 gene haplotype might have utility as a genetic marker for Essential Hypertension and that the RAMP1 gene may be associated with increased susceptibility to Essential Hypertension in a Japanese population.PMID:28181496
Evidence that DNA methylation at RAMP1 gene promoter plays a role in migraine was described.PMID:26501962
RAMP1 rs7590387 has a role in the transformation of episodic migraine into medication overuse headache.PMID:25881990
A novel functional role for RAMP1 in regulation of CaSR signalling in addition to its known role in receptor trafficking, is reported.PMID:24454825
multiple NKX3.1 binding sites were found in the RAMP1 locus in human prostate cancer cells and in the normal mouse prostate.PMID:23867798
RAMP1 overexpression enhances the promoting effect that exogenous CGRP has on osteogenic differentiationPMID:22949393
No significant association of the tested SNPs of the RAMP1 gene were found with migraine susceptibility.PMID:23237777
CLR and RAMP1 co-localize in the enteric nervous system of human stomach, ileum, and colon, and are in close proximity to their ligands CGRP and IMDPMID:22484227
The present finding demonstrated that RAMP1 immunoreactivity was localized in many neurons and phenopalatine ganglion.PMID:22208649
lower expression in bronchial biopsies from subjects with asthmaPMID:20933260
The T-A-C haplotype is a genetic marker for cerebral infarction, and RAMP1 is associated with increased susceptibility to cerebral infarction.PMID:19710695
These data for the first time pinpoint a specific RAMP1 residue important for both antagonist and agonist potency and are consistent with the N-terminal domain of RAMP1 forming the binding pocket interface with calcitonin receptor-like receptor.PMID:20188075
RAMP1 overexpression attenuates Ang-II-induced hypertension and induces a protective change in cardiovascular autonomic regulationPMID:20100989
Co-expression of RAMP1 and CRLR reconstituted a CGRP receptor that was able to activate the pheromone-signaling pathway with pharmacological properties similar to those observed previously in mammalian cells.PMID:11733510
Receptor activity-modifying protein 1 determines the species selectivity of non-peptide CGRP receptor antagonists.PMID:11847213
The extracellular domain of receptor activity-modifying protein 1 is sufficient for calcitonin receptor-like receptor functionPMID:12574158
identification of domains responsible for agonist binding specificityPMID:12684503
TNF-alpha induced time- and dose-dependent decreases in the expression of RAMP1 mRNA in cultured human coronary artery smooth muscle cells, thereby diminishing AM-evoked cAMP productionPMID:15245870
calcitonin receptor-like receptor heterodimer with RAMP1 yields a calcitonin gene-related peptide receptorPMID:15613468
Functional calcitonin gene-related peptide receptors are formed by the asymmetric assembly of a calcitonin receptor-like receptor and RAMP1.PMID:17785463
We did not observe any difference in mRNA for CL-R and RAMPs in arteries from patients with hemorrhagic stroke, arteriosclerosis and acute myocardial infarction when compared to patients without these diagnosesPMID:18198792
RAMP1 may be strongly considered as a candidate gene for migraine.PMID:18240900
Identification of RAMP1 residues important for calcitonin gene-related peptide are reported.PMID:18593822
the crystal structure of the extracellular domain of human RAMP1 at 2.4 A resolution was determined.PMID:18725456
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
RAMP family
Tissue Specificity
Expressed in many tissues including the uterus, bladder, brain, pancreas and gastro-intestinal tract.