Home
Product
Protein
Transmembrane Proteins
Recombinant Human RPE-retinal G protein-coupled receptor (RGR)

Recombinant Human RPE-retinal G protein-coupled receptor (RGR)

Code: CSB-CF019640HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4672

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

RGR

Uniprot NO.

P47804

Alternative Names

RGR; RPE-retinal G protein-coupled receptor

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-291

Target Protein Sequence

MAETSALPTGFGELEVLAVGMVLLVEALSGLSLNTLTIFSFCKTPELRTPCHLLVLSLAL ADSGISLNALVAATSSLLRRWPYGSDGCQAHGFQGFVTALASICSSAAIAWGRYHHYCTR SQLAWNSAVSLVLFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSKGDRNFTSFLFTM SFFNFAMPLFITITSYSLMEQKLGKSGHLQVNTTLPARTLLLGWGPYAILYLYAVIADVT SISPKLQMVPALIAKMVPTINAINYALGNEMVCRGIWQCLSPQKREKDRTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for all-trans- and 11-cis-retinal. Binds preferentially to the former and may catalyze the isomerization of the chromophore by a retinochrome-like mechanism.

Gene References into Functions

The results indicate that the cone photoreceptors of humans and cattle express a nonvisual opsin of the Go/RGR or tetraopsin group. PMID:30034210
study to systemically analyze the potential role of variants of RGR in retinal diseases results of the suggested that the heterozygous truncation variants in RGR were less likely to be pathogenic PMID:27748892
E150K opsin is partially colocalized with the cis/medial Golgi compartment but not with the trans-Golgi network; results are consistent with recessive pattern of inheritance; retinal degeneration results from deficient export of opsin from the Golgi PMID:16737970
These results indicate that after exon-skipping RGR splice isoform (RGR-d) is synthesized, the RGR-d epitope is released at the basal surface of the retinal pigment epithelium and deposited into Bruch's membrane in human eyes throughout adult life. PMID:17679941
RGR-opsin mediates light-dependent translocation of all-trans-retinyl esters from a storage pool in lipid droplets to an "isomerase pool" in membranes of the endoplasmic reticulum. PMID:18474598
the exon-skipping variant of RGR (RGR-d) is found in extracellular deposits;at the base of early-stage drusen mounds in the older donors and may precede the formation of these drusen PMID:19450444