Recombinant Human Protein reprimo (RPRM)

Code: CSB-CF868308HU
Size:
20μg
20μg100μg
US$3310
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
RPRM
Uniprot NO.
Alternative Names
RPRM; Protein reprimo
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-109
Target Protein Sequence
MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.
Gene References into Functions
  1. rawing on embryonic and adult expression patterns, we address the potential relevance of RPRM and RPRML in cancer. Active investigation or analytical research in the coming years should contribute to novel translational applications of this poorly understood gene family as potential biomarkers and development of novel cancer therapies. PMID:29941787
  2. Reprimo methylation was found more frequently in malignant intraductal papillary mucinous neoplasm (IPMN), suggesting reprimo methylation is involved in malignant transformation of IPMNs. PMID:29401170
  3. data suggest that ERalpha expression in breast cancer may affect the DNA methylation of CpG-island in the RPRM gene. PMID:28809778
  4. tissue-specific expression patterns of the RPRM transcripts and protein are conserved between zebrafish and humans. We propose the zebrafish as a powerful tool to elucidate the both physiological and pathological roles of the RPRM gene family PMID:28562620
  5. Results provide evidence that RPRM promoter methylation is highly associated with gastric cancer. PMID:27992600
  6. The DNA methylation of both Reprimo and hMLH1 genes depressed the protein expression, and may participate in the occurrence and progression and gastric cancer PMID:26823831
  7. tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia PMID:25629980
  8. Positive association between RPRM and p73 expression suggest that other members of the p53 gene family may participate in the regulation of RPRM expression. PMID:25954972
  9. Loss of expression of Reprimo (RPRM), a p53-induced cell cycle arrest gene correlates with invasive stage of tumor progression and p73 expression in gastric cancer. These findings suggest that other members of the p53 gene family may participate in the regulation of RPRM expression PMID:25954972
  10. Reprimo expression is normally induced in response to DNA damage, acting as a novel tumor suppressor in gastric cancer; however, Reprimo methylation abrogates its expression and effects PMID:23982217
  11. study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo PMID:23312294
  12. RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation PMID:22562171
  13. Loss of Reprimo and S100A2 expressions occurs frequently in gastric adenocarcinomas. The expressions of Reprimo and S100A2 may be potential biomarkers for gastric adenocarcinomas detection. PMID:20949468
  14. these data implicate a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM. PMID:19917725
  15. Results suggest that aberrant methylation of Reprimo is a common event in pancreatic carcinogenesis and is associated with genetic instability. PMID:16752411
  16. An association between the Reprimo 824G>C heterozygote and diverticular disease may exist on the basis of deviation from Hardy-Weinberg equilibrium. PMID:18197409
  17. Aberrant hypermethylation of Reprimo is high in primary gastric cancer as well as in pair plasma samples. In plasma from asymptomatic controls, Reprimo is infrequently methylated. Reprimo is a potential biomarker for early detection of gastric cancer. PMID:18829507

Show More

Hide All

Subcellular Location
Cytoplasm. Membrane; Single-pass membrane protein.
Protein Families
Reprimo family
Database Links

HGNC: 24201

UNIGENE: Hs.100890

KEGG: hsa:56475

STRING: 9606.ENSP00000314946

OMIM: 612171

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products