Recombinant Human Protein reprimo (RPRM)

Code: CSB-CF868308HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3310

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

RPRM

Uniprot NO.

Q9NS64

Alternative Names

RPRM; Protein reprimo

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-109

Target Protein Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex.

Gene References into Functions

rawing on embryonic and adult expression patterns, we address the potential relevance of RPRM and RPRML in cancer. Active investigation or analytical research in the coming years should contribute to novel translational applications of this poorly understood gene family as potential biomarkers and development of novel cancer therapies. PMID:29941787
Reprimo methylation was found more frequently in malignant intraductal papillary mucinous neoplasm (IPMN), suggesting reprimo methylation is involved in malignant transformation of IPMNs. PMID:29401170
data suggest that ERalpha expression in breast cancer may affect the DNA methylation of CpG-island in the RPRM gene. PMID:28809778
tissue-specific expression patterns of the RPRM transcripts and protein are conserved between zebrafish and humans. We propose the zebrafish as a powerful tool to elucidate the both physiological and pathological roles of the RPRM gene family PMID:28562620
Results provide evidence that RPRM promoter methylation is highly associated with gastric cancer. PMID:27992600
The DNA methylation of both Reprimo and hMLH1 genes depressed the protein expression, and may participate in the occurrence and progression and gastric cancer PMID:26823831
tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia PMID:25629980
Positive association between RPRM and p73 expression suggest that other members of the p53 gene family may participate in the regulation of RPRM expression. PMID:25954972
Loss of expression of Reprimo (RPRM), a p53-induced cell cycle arrest gene correlates with invasive stage of tumor progression and p73 expression in gastric cancer. These findings suggest that other members of the p53 gene family may participate in the regulation of RPRM expression PMID:25954972
Reprimo expression is normally induced in response to DNA damage, acting as a novel tumor suppressor in gastric cancer; however, Reprimo methylation abrogates its expression and effects PMID:23982217
study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo PMID:23312294
RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation PMID:22562171
Loss of Reprimo and S100A2 expressions occurs frequently in gastric adenocarcinomas. The expressions of Reprimo and S100A2 may be potential biomarkers for gastric adenocarcinomas detection. PMID:20949468
these data implicate a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM. PMID:19917725
Results suggest that aberrant methylation of Reprimo is a common event in pancreatic carcinogenesis and is associated with genetic instability. PMID:16752411
An association between the Reprimo 824G>C heterozygote and diverticular disease may exist on the basis of deviation from Hardy-Weinberg equilibrium. PMID:18197409
Aberrant hypermethylation of Reprimo is high in primary gastric cancer as well as in pair plasma samples. In plasma from asymptomatic controls, Reprimo is infrequently methylated. Reprimo is a potential biomarker for early detection of gastric cancer. PMID:18829507