Home
Product
Protein
Transmembrane Proteins
Recombinant Human Prolactin-releasing peptide receptor (PRLHR)

Recombinant Human Prolactin-releasing peptide receptor (PRLHR)

Code: CSB-CF018726HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5263

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

PRLHR

Uniprot NO.

P49683

Alternative Names

PRLHR; GPR10; GR3; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10; hGR3

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-370

Target Protein Sequence

MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH GQNMTVSVVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.

Gene References into Functions

Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. PMID:26211894
The genotype "A/T" of rs12413624 in PRLHR gene was associated with a decreased risk of colorectal cancer. PMID:26302849
demonstrate previously unrecognized roles for GPR10 and its upstream regulator REST in the pathogenesis of uterine fibroids PMID:23284171
structural analysis of the human PrRP receptor (PrRPR) and the ligand-mimicking receptor variant of prolactin-releasing peptide PMID:22778259
cloning and characterization of the human PrRP receptor gene and its promoter region (PRL-releasing peptide receptor; PrRPR) PMID:11923475
PrRP receptor has a likely role in pheochromocytomas, based on its high expression in tumor tissue PMID:12126742
The neuron-restrictive silencer factor confers transcriptional repression of the GPR10 gene via a putative silencer element located in the 5' promoter region. PMID:12417311
There is an association of polymorphisms in this gene with blood pressure, but not obesity, in a U.K. Caucasian population. PMID:12716769
A ligand for The rat orphan receptor UHR-1. PMID:15752583