Recombinant Human Prolactin-releasing peptide receptor (PRLHR)

Code: CSB-CF018726HU
Size:
20μg
20μg100μg
US$5263
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
PRLHR
Uniprot NO.
Alternative Names
PRLHR; GPR10; GR3; Prolactin-releasing peptide receptor; PrRP receptor; PrRPR; G-protein coupled receptor 10; hGR3
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-370
Target Protein Sequence
MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLK GLIVLLYSVVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAY AFEPRGWVFGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAV LAIWALSAVLALPAAVHTYHVELKPHDVRLCEEFWGSQERQRQLYAWGLLLVTYLLPLLV ILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLLVVIVVVFAVCWLPLHVFNLL RDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLLVAWPRKIAPH GQNMTVSVVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for prolactin-releasing peptide (PrRP). Implicated in lactation, regulation of food intake and pain-signal processing.
Gene References into Functions
  1. Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. PMID:26211894
  2. The genotype "A/T" of rs12413624 in PRLHR gene was associated with a decreased risk of colorectal cancer. PMID:26302849
  3. demonstrate previously unrecognized roles for GPR10 and its upstream regulator REST in the pathogenesis of uterine fibroids PMID:23284171
  4. structural analysis of the human PrRP receptor (PrRPR) and the ligand-mimicking receptor variant of prolactin-releasing peptide PMID:22778259
  5. cloning and characterization of the human PrRP receptor gene and its promoter region (PRL-releasing peptide receptor; PrRPR) PMID:11923475
  6. PrRP receptor has a likely role in pheochromocytomas, based on its high expression in tumor tissue PMID:12126742
  7. The neuron-restrictive silencer factor confers transcriptional repression of the GPR10 gene via a putative silencer element located in the 5' promoter region. PMID:12417311
  8. There is an association of polymorphisms in this gene with blood pressure, but not obesity, in a U.K. Caucasian population. PMID:12716769
  9. A ligand for The rat orphan receptor UHR-1. PMID:15752583

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Only detected in the pituitary gland and in all cell types of pituitary adenomas.
Database Links

HGNC: 4464

UNIGENE: Hs.248119

KEGG: hsa:2834

STRING: 9606.ENSP00000239032

OMIM: 600895

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products