Home
Product
Protein
Transmembrane Proteins
Recombinant Human Potassium channel subfamily K member 17 (KCNK17)

Recombinant Human Potassium channel subfamily K member 17 (KCNK17)

Code: CSB-CF836305HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4979

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

KCNK17

Uniprot NO.

Q96T54

Alternative Names

KCNK17; TALK2; TASK4; UNQ5816/PRO19634; Potassium channel subfamily K member 17; 2P domain potassium channel Talk-2; Acid-sensitive potassium channel protein TASK-4; TWIK-related acid-sensitive K(+ channel 4; TWIK-related alkaline pH-activated K(+ channel 2; TALK-2

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-332

Target Protein Sequence

MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.

Gene References into Functions

The results suggested that heterodimerization of TASK1 and TALK2 provides cells with the ability to make multiple responses to a variety of physiological and pharmacological stimuli. PMID:29016681
The T carrier of an single-nucleotide polymorphism is associated with reduced risk of cerebral hemorrhage in the Chinese population. PMID:25179130
This study demonstrates that Gly88 is a crucial residue for normal TASK-4 gating behavior and that the channel is strongly expressed in the cardiac conduction system. PMID:24972929
The rs10947803 SNP (A allele) in KCNK17 increases the risk of cerebral hemorrhage but not ischemic stroke in the Chinese population. PMID:23391755
The A allele of the rs10947803 variant of KCNK17 was associated with increased risk of IS and increased levels of KCNK17 gene expression. PMID:19647252