Home
Product
Protein
Transmembrane Proteins
Recombinant Human Potassium channel subfamily K member 16 (KCNK16)

Recombinant Human Potassium channel subfamily K member 16 (KCNK16)

Code: CSB-CF850434HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4807

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

KCNK16

Uniprot NO.

Q96T55

Alternative Names

KCNK16; TALK1; Potassium channel subfamily K member 16; 2P domain potassium channel Talk-1; TWIK-related alkaline pH-activated K(+ channel 1; TALK-1

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-309

Target Protein Sequence

MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLAAIERWEDRPRRSQVLQVLGLALFLTLGT LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF PISKKGLGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Outward rectifying potassium channel. Produces rapidly activating and non-inactivating outward rectifier K(+) currents.

Gene References into Functions

data establish TALK-1 channels as key regulators of beta cell ER Ca(2+) and suggest that TALK-1 may be a therapeutic target to reduce ER Ca(2+) handling defects in beta cells during the pathogenesis of diabetes. PMID:28928238
The TALK-1/iOPN complex caused Vm hyperpolarization and reduced beta-cell glucose-stimulated Ca2+ influx, which is predicted to inhibit glucose stimulated insulin secretion. PMID:28403169
These findings reveal TALK-1 channels as important modulators of second-phase insulin secretion and suggest a clinically relevant mechanism for rs1535500, which may increase type 2 diabetes risk by limiting glucose-stimulated insulin secretion. PMID:26239056
at least two functional TALK-1 variants are present and may serve as background K+ currents in certain cells of the human pancreas. PMID:12724142