MEPHDSSHMDSEFRYTLFPIVYSIIFVLGVIANGYVLWVFARLYPCKKFNEIKIFMVNLT MADMLFLITLPLWIVYYQNQGNWILPKFLCNVAGCLFFINTYCSVAFLGVITYNRFQAVT RPIKTAQANTRKRGISLSLVIWVAIVGAASYFLILDSTNTVPDSAGSGNVTRCFEHYEKG SVPVLIIHIFIVFSFFLVFLIILFCNLVIIRTLLMQPVQQQRNAEVKRRALWMVCTVLAV FIICFVPHHVVQLPWTLAELGFQDSKFHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF RKHLTEKFYSMRSSRKCSRATTDTVTEVVVPFNQIPGNSLKN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for platelet activating factor, a chemotactic phospholipid mediator that possesses potent inflammatory, smooth-muscle contractile and hypotensive activity. Seems to mediate its action via a G protein that activates a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
he PAFR gene rs5938 or rs313152 polymorphisms might be a potential biomarker for susceptibility to coronary heart disease.PMID:28197937
Weighted gene co-expression network analysis of gene modules for the prognosis of esophageal cancer yielded PTAFR and FGR as the most important hub genes for predicting patient survival.PMID:28585144
we demonstrate that PAFR inhibition can selectively enhances the sensitivity of radiotherapy in prostate cancer cells with elevated PAFR expression after irradiation exposurePMID:28099922
PAFR overexpression is associated with pneumococcal infection.PMID:28278175
WEB-2086 represents an innovative class of candidate drugs for inhibiting PAFr-dependent lung infections caused by the main bacterial drivers of smoking-related COPD.PMID:27524890
PAF stimulation dose-dependently promoted the invasion, migration and growth of prostate cancer cells in vitro, while knockdow our findings demonstrate that PAFR can activate ERK1/2 pathway, and subsequently increase MMP-3 expression and decrease E-cadherin expressionPMID:27176648
PAFR is overexpressed in NSCLC as well as in breast, colorectal, and gastric carcinomas. PAFR expression correlates with clinical stages, survival time, and distant metastasis. PAF/PAFR signaling also upregulated IL6 expression and STAT3 activation.PMID:26359459
we made the first demonstration that dysregulation of PAFR and the positive regulatory loop between PAFR and pAKT contribute to malignant progression of esophageal squamous cell carcinomaPMID:25639872
Data support an important role for PAFR in tumor growth and suggest that engagement of PAFR interferes with selected pathways in macrophages, changing their phenotype into that of a regulatory with suppressor activities. [review]PMID:25182608
Epithelial PAFr expression is upregulated in smokers, especially in those with COPD, and is not obviously affected by inhaled corticosteroid therapy.PMID:25143722
Results suggest that WEB2086 and AG1478 are synergistic in ovarian cancer cells with high expression of both platelet-activating factor receptor (PAFR) and epidermal growth factor receptor (EGFR).PMID:24886678
PAFR may have an important role in modulating the cisplatin sensitivity of ovarian cancer cells.PMID:24921917
patients presenting elevated PAFR expression had significantly longer survival times compared to those with low PAFR expression (log-rank test, p<0.001).PMID:24824933
oxLDL induces the recruitment of PAFR and CD36 into the same lipid rafts, which is important for oxLDL uptake and IL-10 productionPMID:24130805
Data suggest PAF/PAF receptor signaling exerts proinflammatory effect on neutrophil via down-regulation of LXRa (liver X receptor alpha) and target genes (ATP-binding cassette transporter (ABC) A1, ABC G1, sterol response element binding protein 1c).PMID:24289152
Inhibition of platelet aggregation by lipoteichoic acid was blocked using a monoclonal anti-PafR antibody and Ginkgolide B,a well-defined PafR antagonist, demonstrating that the LTA inhibitory signal occurs via PafR.PMID:23911710
oxLDL induces alternative macrophage activation by mechanisms involving CD36 and PAFRPMID:24062612
Data suggest that expression of PAFR and SIRT1 (sirtuin 1) is down-regulated in endothelial progenitor cells of type 2 diabetic patients with poor glycaemic control compared to those with good glycaemic control.PMID:23070058
An implication of platelet-activating factor receptor A224D mutation in the susceptibility to relapsing-remitting multiple sclerosis in Tunisian population.PMID:21658861
recognition of apoptotic cells by phagocytes leads to activation of PAFR pathways, resulting in a microenvironment response favorable to melanoma growthPMID:22577252
PAFR may have a role in tumor response mechanisms, such as stress responses caused by chemotherapeutic agentsPMID:22570511
Eosinophils use their platelet-activating factor receptors (PAFRs) to interact directly with Staphylococcus aureus.PMID:22595142
Pneumococcal ligands keratin 10, laminin receptor and platelet-activating factor receptor are elevated in aged lungs and contribute to the enhanced susceptibility to pneumonia.PMID:21615674
Urban particulate matter (PM) increases adhesion of S. pneumoniae to human airway epithelial cells. PM-stimulated adhesion is mediated by oxidative stress and PAFR.PMID:21247619
Platelet-activating factor plays a pivotal role in the oxLDL-induced recruitment of hBMSCs through mechanisms involving platelet-activating factor receptor dependent activation of Mitogen-Activated Protein Kinases.PMID:21063106
The expression of PAF receptor (PAF-R) in early endothelial progenitor cell and the release of PAF under stimulation with factors involved in endothelial dysfunction, were investigated.PMID:20637897
Results reveal that some strains of Gram-positive bacteria exploit hypoxia-inducible factor 1 alpha-regulated platelet-activating factor receptor as a means for translocation through intestinal epithelial cells.PMID:20032301
role in activation of mast cells by PAF.PMID:20392487
conserved proline in TM6 is crucial for intracellular trafficking of PAFR.PMID:20007715
activates the extracellular signal-regulated kinase mitogen-activated protein kinase and induces proliferation of epidermal cellsPMID:11861812
Neuroblastoma clone cells show an inverse relationship between invasiveness and differentiative capacity and by the expression of specific cell surface PAF receptors.PMID:11928813
PAF receptor transcripts in five human cancer cell lines derived from the breast (BT20, SKBR3 and T47D cells), the pancreas (Miapaca cells) and the bladder (5,637 cells) confirm the existence of a splice variant of the PAF-R transcript 2.PMID:12467527
a novel pathway whereby the epidermal PAF-R can augment chemotherapy-induced apoptotic effects through an NF-kappaB-dependent processPMID:12601006
the epidermal platelet-activating factor receptor augments staphylococcal alpha-toxin signalingPMID:12713583
platelet-activating factor receptor is desensitized and internalized by coumermycin-gyrase B-induced dimerizationPMID:12756251
PAFR degradation can occur via both the proteasome and lysosomal pathways and ligand-stimulated degradation is ubiquitin-dependentPMID:14500726
platelet-activating factor receptor-mediated signaling has a critical role in differentiated endothelial cell functions, including cell migration and proteolytic activation of MMP2PMID:14617636
investigated whether the increase of uPA monocyte expression and chemokine releases induced by oxidised low density lipoproteins involved proinflammatory phospholipid products having platelet-activating factor-like activity via the PAFR pathwayPMID:15149885
Analysis of 102 B-CLL patients revealed dramatic differences for their membrane PAF-R expression, a result that might be related to their plasma IL-4 levels.PMID:15160913
the PAFR gene missense mutation has a relation to the susceptibility for multiple sclerosis .PMID:15748960
UVB photo-oxidizes cellular phospholipids, creating PAF analogs that stimulate the PAF receptor to induce further PAF synthesis and apoptosisPMID:16115894
PAF induced CREB and ATF-1 phosphorylation via a PAFR-mediated signal transduction mechanism that required pertussis toxin-insensitive Galphaq protein and adenylate cyclase activity and was antagonized by a cAMP-dependent PKA and p38 MAPK inhibitors.PMID:16306050
presence of functional PAF-R in arterial spindle-shaped smooth muscle cells of synthetic phenotype may be important for their migration from the media into the intima and atherosclerotic plaques formationPMID:16793019
The functional PAF-R are present in blast cells of patients with acute leukemia; a result that could be of physiologic importance regarding the important effect of PAF on leukocytes maturation and functions.PMID:16837045
These studies suggest that SZ95 sebocytes express functional PAF-Rs and PAF-Rs are involved in regulating the expression of inflammatory mediators, including COX-2, PGE(2) and IL-8.PMID:16984258
epidermal PAF-R can modulate UVB-mediated early gene expressionPMID:17928889
a lower expression of PAFR in HCC correlated with both poor differentiation and portal venous invasion.PMID:18187960
analysis of PAFR activation and pleiotropic effects on tyrosine phospho-EGFR/Src/FAK/paxillin in ovarian cancerPMID:18632638
cis-urocanic acid stimulates mediator production by a pathway that is independent of these serotonin 2A and PAF receptors in human keratinocytesPMID:19474802
PAFR is localized in lipid rafts and/or caveolae, a position that is important for proper coupling to downstream signaling elements.PMID:19620302
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the placenta, lung, left and right heart ventricles, heart atrium, leukocytes and differentiated HL-60 granulocytes.