ADCYAP1R1; Pituitary adenylate cyclase-activating polypeptide type I receptor; PACAP type I receptor; PACAP-R-1; PACAP-R1
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
21-468
Target Protein Sequence
MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPEL FRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTEDGWSEPFPHYFDACGFDEYE SETGDQDYYYLSVKALYTVGYSTSLVTLTTAMVILCRFRKLHCTRNFIHMNLFVSFMLRA ISVFIKDWILYAEQDSNHCFISTVECKAVMVFFHYCVVSNYFWLFIEGLYLFTLLVETFF PERRYFYWYTIIGWGTPTVCVTVWATLRLYFDDTGCWDMNDSTALWWVIKGPVVGSIMVN FVLFIGIIVILVQKLQSPDMGGNESSIYLRLARSTLLLIPLFGIHYTVFAFSPENVSKRE RLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFAVDFKHRHPSLASSGV NGGTQLSILSKSSSQIRMSGLPADNLAT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
Gene References into Functions
These results show that b-arrestin1 and b-arrestin2 exert differential actions on PAC1R internalization and PAC1R-dependent ERK1/2 activation, and suggest that the two b-arrestin isoforms may be involved in fine and precise tuning of the PAC1R signaling pathways.PMID:29734363
Studies suggest that the level of stress and circulating gonadal hormones may differentially regulate the PACAPergic system in males and females to influence anxiety-like behavior and may be one mechanism underlying the discrepancies in human psychiatric disorders. [Review Article]PMID:28610473
These results provide evidence for an association between ADCYAP1R1 and PTSD and indicate that there may indeed be sex differences.PMID:28746747
These findings lead to a model in which E2 induces the expression of ADCYAP1R1 through binding of ERalpha at the ERE as an adaptive response to stress. Inhibition of E2/ERalpha binding to the ERE containing the rs2267735 risk allele results in reduced expression of ADCYAP1R1, diminishing estrogen regulation as an adaptive stress response and increasing risk for PTSD.PMID:27959335
Data suggest that GCGR (glucagon receptor) activation proceeds via a mechanism in which transmembrane helix 6 (TM6) is held in an inactive conformation by a conserved polar core and a hydrophobic lock (involving intracellular loop 3, IC3); mutations in the corresponding polar core of GCGR or PAC1R disrupt these inhibitory elements, allow TM6 to swing outward, and induce constitutive G protein signaling.PMID:28356352
Results confirmed for the first time that doxycycline specially targeted pituitary adenylate cyclase-activating polypeptide (PACAP) receptor type 1 (PAC1) imitating PACAP(30-37) and acted as an enhancer by facilitating the subsequent ligand binding and the activation of PAC1.PMID:26700245
Rsults suggest that impaired contextual conditioning in the hippocampal formation may mediate the association between type I receptor of the pituitary adenylate cyclase activating polypeptideand and posttraumatic stress disorder symptoms.PMID:25680674
Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated.PMID:26343289
Further investigations of genetic factors for trauma-related psychopathology should include careful assessments of the social environmentPMID:26334183
High child stress and an ADCYAP1R1 single-nucleotide polymorphism are associated with reduced bronchodilator response in children with asthma.PMID:25918834
and its receptor (PAC1) are involved in stress response and anxiety.PMID:23972788
association of variants with sudden infant death not supportedPMID:23981011
PAC1/PACAP receptor endocytosis contributes to ERK acktivation.PMID:24696141
This review focuses on role of PAC1 receptor in brain development, behavior of transgenic animals and potential implication in human neurodevelopmental disorders.PMID:24220567
PAC1 receptor (ADCYAP1R1) genotype is associated with dark-enhanced startle in both male and female children.PMID:22776899
Individual differences in ADCYAP1R1 genotype may contribute to dysregulated fear circuitry known to play a central role in posttraumatic stress disorder and other anxiety disorders.PMID:24516127
Data indicate that VIP and PACAP increased macrophage resistance to HIV-1 replication by inducing the synthesis of beta-chemokines CCL3 and CCL5 and IL-10 following preferential activation of the receptors VPAC2 and PAC1.PMID:23818986
The findings suggest that the PACAP-PAC1 receptor pathway may play an important role in female human responses to traumatic stressPMID:23394710
ADCYAP1R1 genotype may have a role in post-traumatic stress symptoms in highly traumatized African-American femalesPMID:23505260
Genetic variation at the ADCYAP1R1 locus interacts with child abuse to shape risk of later posttraumatic stress disorder (PTSD) in women.PMID:23280952
Epigenetic and genetic variants in ADVYAP1R1 are associated with asthma in Puerto Rican children.PMID:23328528
[review] The Adcyap1r1 receptor single nucleotide polymorphism (SNP) is located within a predicted estrogen response element (ERE).PMID:23147486
Conclude that VPAC2/PAC1 receptors require NO in series to effect cutaneous active vasodilation during heat stress in humans.PMID:22961270
The increased expressions of PAC1 receptors on lactating breast may indicate a PACAP38/PAC1 interaction in the mammary gland during lactation.PMID:22539193
PAC1 regulates PYK-2 tyrosine phosphorylation in a calcium-dependent manner in lung cancer cell lines.PMID:22581436
Activation of Sp1 by the Ras/MAPK pathway might participate in neuron specific expression of the PAC1 gene.PMID:22609358
A reported association between rs2267735 and PTSD could not be replicated in either African American or European American females in two large independent samples.PMID:21912390
The present study constitutes the first characterization of the binding domains of PACAP to its specific receptor PAC1 and suggests heterogeneity within the binding mode of peptide ligands to class B GPCRs.PMID:21185349
VPAC2 and/or PAC1 receptor activation is involved in cutaneous active vasodilation in humans.PMID:20395540
Results indicate that VPAC1, but not VPAC2 or PAC1, up-regulation in macrophages is a common mechanism in response to acute and chronic pro-inflammatory stimuli.PMID:20026142
PACAP receptor type 1 mRNA is expressed in the trigeminal, otic and superior cervical ganglia (prejunctional) and cerebral arteries (postjunctional).PMID:11930171
HCT8 human colon tumor cells express PAC1, and PAC1 activation is coupled to adenylate cyclase, increase cytosolic [Ca(2+)](i), and cellular proliferationPMID:12409223
Using GST pull-down assay, ARF6 binds to the hop1 but not the null domain of PAC1 receptorPMID:12409233
receptors were positively coupled to adenylyl cyclase in human lung cancer, but the enzyme activity was impaired as compared to normal lungPMID:12732341
Expression of functional PAC(1), VPAC(1) and VPAC(2) receptors in human prostate as well as its maintenance after malignant transformationPMID:12948842
In colon cancer cell lines, PAC1 is expressed as the SV1 or HIP splice variant and is coupled to the activation only of cAMP but not of intracellular Ca2+.PMID:14742913
PAC(1)-R null variant is the most relevant isoform expressed in human prostaste cancer, and may be related with the events determining the outcome of prostate cancer.PMID:16372333
Stimulation of endogenously expressed PAC1 receptors with PACAP in human neuroblastoma cells increased APPsalpha secretion. PAC1R activation stimulates ERK phosphorylation.PMID:16401644
PAC1-R is the predominant PACAP receptor found in fetuses, and both PAC1-R and VPAC1-R are expressed in the mature cerebellum.PMID:16572459
Data demonstrate that altered neuronal proliferation/apoptosis and disrupted ependymal cilia are the main factors contributing to hydrocephalus in PAC1-overexpressing mice.PMID:16823490
PACAP may regulate the biological release of peptides and serotonin from BON cellsPMID:16888199
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.