MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISI GTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILL YLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLG QSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSL SDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFR QKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQG IDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR LLDSSC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Structural component of the gap junctions and the hemichannels involved in the ATP release and nucleotide permeation. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis. Plays a critical role in oogenesis.
Gene References into Functions
Progressive PANX1 channel opening is directly linked to permeation of ions and large and occurs during both irreversible and reversible forms of channel activation. This unique, quantized activation process enables fine tuning of PANX1 channel activity and may be a generalized regulatory mechanism for other related multimeric channels.PMID:28134257
authors proposed a tentative intracellular signaling pathway of the acetylcholine-induced ciliary beat, in which the pannexin-1-purinergic P2X receptor unit may play a central role in ciliary beat regulationPMID:29676177
These results newly identify Pannexin-1 as a protein highly expressed in human dermal lymphatic endothelial cells.PMID:29882918
The pannexin 2 (Panx2) N86Q mutant is glycosylation-deficient and tends to aggregate in the endoplasmic reticulum (ER)reducing its cell surface trafficking but it can still interact with pannexin 1 (Panx1).PMID:29932112
All three pannexins Panx1, Panx2, and Panx3 mRNAs were expressed in all of the analyzed undifferentiated stem cell lines.PMID:29357945
These results elucidate for the first time PNX1-hemichannels as potentially main extracellular translocation pathway for NDKs from an intracellular pathogen.PMID:27883084
Pannexin1 (Panx1) was suggested to be functionally associated with purinergic P2X and N-methyl-D-aspartate (NMDA) receptor channels. Activation of these receptor channels by their endogenous ligands leads to cross-activation of Panx1 channels. This in turn potentiates P2X and NMDA receptor channel signaling.PMID:28389204
The ubiquitous expression, as well as its function as a major ATP release and nucleotide permeation channel, makes Panx1 a primary candidate for participating in the pathophysiology of CNS disorders.PMID:28735901
Panx1 was mainly distributed in microcolumn neurons, dysmorphic neurons, balloon cells and reactive astrocytes in cortical lesions from intractable epilepsy patients with focal cortical dysplasia.PMID:28036289
ATP release from red blood cells is not mediated by the cAMP-mediated Panx1 pathway.PMID:28855161
Panx1 channels are involved in beta-toxin-induced cell death.PMID:27720686
Pannexin1 is a mediator of inflammation and cell death. (Review)PMID:27741412
Panx1 channels promote skeletal muscle myoblast differentiation and fusion. (Review)PMID:27518505
presence of the Panx1-400C allele was not associated with platelet reactivity in stable cardiovascular patients.PMID:28142297
Overactive Panx-1 promotes cancer cell survival in the context of mechanical deformation. Panx-1 inhibitors can be used to treat highly metastatic cancer. Mechanosensitive Panx-1 channels will be a new target for the prevention of metastasis and stress-induced diseases.PMID:27025600
The results of this study do not support a major contribution of PANX1-3 to disease risk of schizophrenia according to DSM-5.PMID:26223428
a pivotal role of P2X7 receptor-pannexin-1 in oxysterols toxicity in retinal cellsPMID:27109381
Data indicate that the consanguineous parents are each heterozygous for Pannexin1 (PANX1) but are not affected by the multiorgan syndromes.PMID:27129271
CBX and other inhibitors, including probenecid, attenuate Panx1 channel activity through modulation of the first extracellular loop.PMID:26755773
Decreased Panx1 function is a response to cell acidification mediated by IFN-gamma-induced up-regulation of Duox2.PMID:26823467
PANX-1 plays an important role in the release of cytokines and glutamate in a tumor cell line.PMID:26385361
The frequency of Panx1-400C homozygotes was higher among cardiovascular patients with hyper-reactive platelets. The Panx1-400C variant encodes a gain-of-function channel that enhances collagen-induced ATP release and platelet aggregation.PMID:25947940
Pannexin1-dependent pathophysiological eATP release in lipoapoptosis is capable of stimulating migration of human monocytesPMID:26054298
Panx1 channels promote leukocyte adhesion and emigration through the venous wall during acute systemic inflammation.PMID:26242575
This review focuses on the known roles of Panx1 related to purinergic signalling in the vasculature focusing on post-translational modifications and channel gating mechanisms that may participate in the regulated release of ATP.PMID:26009197
Within this review, the regulation of Panx1 channels is discussed, with a focus on how they may contribute to platelet function.PMID:26009198
These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7RsPMID:25170954
Data show that mutation encoding a truncated form of the pannexin-1 (PANX1) channel, PANX1(1-89), as recurrently enriched in highly metastatic breast cancer cells.PMID:26098574
Pannexin-1 is not involved in the P2X7 mediated uptake of dye in Hek-293 cells.PMID:24671093
Panx1 is expressed on human platelets and amplifies Ca(2+) influx, ATP release and aggregation through the secondary activation of P2X1 receptors.PMID:24655807
Pannexin-1 channel is involved in cigarette smoke-induced ATP release in the lung.PMID:25301060
The critical involvement of Panx1 despite its absence in epiplexus cells was while it was not surprising that ATP could activate the epiplexus cells.PMID:24418937
Panx1 and Panx3 are co-expressed in human skeletal muscle myoblasts and play a pivotal role in dictating the proliferation and differentiation.PMID:25239622
Chemotherapeutic drugs also activated an alternative caspase- and Panx1-independent pathway for ATP release from Jurkat cells in the presence of benzyloxycarbonyl-VAD, a pan-caspase inhibitor.PMID:25112874
Data suggest that both up-regulation and down-regulation of expression of pannexins (PANX1, PANX2, PANX3) are associated with disease onset and/or progression; examples include neoplasms, multiple sclerosis, migraine, and hypertension. [REVIEW]PMID:25008946
These findings suggest that nonmetal hapten reactivity to thiol residues causes membrane disruption of keratinocytes and reactive oxygen species production that leads to ATP release through opening of Panx hemichannels.PMID:24531690
Panx1 and Panx2 expression was detected in the temporal lobe cortex of patients with temporal lobe epilepsy and in the control tissues.PMID:24146091
data identify a novel linkage between an antibiotic, pannexin channels and cellular integrity, and suggest that re-engineering certain quinolones might help develop newer antibacterialsPMID:24646995
P2X4 assembles with P2X7 and pannexin-1 in gingival epithelial cells and modulates ATP-induced reactive oxygen species production and inflammasome activation during P. gingivalis infection.PMID:23936165
Pannexin-1 immunoreactivity was mainly localized to enteric ganglia, blood vessel endothelium, erythrocytes, epithelial and goblet cells. In ulcerative colitis myenteric ganglia, there was a significant reduction in Panx1.PMID:23594276
Panx1 localizes to chlamydial inclusions but its absence does not effect chlamydial development during infection of cells.PMID:23700432
histamine induces ATP release from human subcutaneous fibroblasts, via pannexin-1 hemichannels, leading to [Ca(2+)]i mobilization and cell growth through the cooperation of H1 and P2 (probably P2Y1) receptors.PMID:23918924
Blocking Panx1 hemichannels by reducing their opening or protein expression inhibited HIV replication in CD4(+) T lymphocytesPMID:23456773
findings suggest that chemoattractant receptors require PANX1 to trigger excitatory and inhibitory signals that synergize to fine-tune chemotactic responses at the front and back of neutrophilsPMID:23798685
Overexpression of Panx1 in THP-1 cells also failed to increase the infl ammasome activity as revealed by similar IL-1beta and caspase-1 activity in comparison with normal THP-1 cellsPMID:23549611
S-nitrosylation of Panx1 at Cys-40 and Cys-346 inhibits Panx1 channel currents and ATP release.PMID:23033481
Panx1 level is modulated during keratinocyte differentiation and carcinogenesis and reveal distinct localization pattern for Panx1 in human adnexal structures.PMID:22947051
These results suggest that panx1 contributes to pathophysiological ATP release in lipoapoptosis induced by saturated FFA; panx1 may play a role in hepatic inflammation by mediating an increase in extracellular ATP concentration in lipotoxic liver injury.PMID:22972801
while Panx1 is present in skin melanocytes it is up-regulated during melanoma tumor progression, and tumorigenesis can be inhibited by the knockdown of Panx1 raising the possibility that Panx1 may be a viable target for the treatment of melanoma.PMID:22753409