MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL FYFTQKKFRRRPHELLQKLTAKWQRQGR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
Prostaglandin E2 glyceryl ester is an endogenous agonist of the nucleotide receptor P2Y6.PMID:28539604
The present study shows that sustained activation of P2Y6R may contribute to intestinal tumorigenesis by blocking the apoptotic process and by contributing to chemoresistance, a substantial concern in the treatment of patients with CRC.PMID:29454075
UDP/P2Y6 receptor signaling is involved in the regulation of IgE-dependent degranulation in basophils, which might stimulate the P2Y6 receptor via the autocrine secretion of UTP. Thus, this receptor represents a potential target to regulate IgE-dependent degranulation in basophils during allergic diseases.PMID:28318884
Expression levels of P2Y6 receptor were higher in Parkinson's disease patients compared to healthy controls.PMID:28219441
These data suggest that, without infection, inactivated-H5N1 induces mRNA expression of IL-6 and CXCL8 by a mechanism, or mechanisms, requiring interaction between viral hemagglutinin and alpha-2,3 sialic acid receptors at the cell membrane of host cells, and involves activation of P2Y6 purinergic receptors.PMID:28494003
Rescuing miR-185 expression to inhibit P2Y6 may represent a therapeutic strategy against human aortic vascular smooth muscle cells dysfunction and hypertension.PMID:28277742
data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells.PMID:25816245
nucleotides released during the airway inflammatory processes will activate P2Y6 receptors, which will lead to further release of inflammatory cytokines.PMID:25243587
Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA).PMID:23723068
Using rat P2Y6 recombinant protein expressed in human astrocytoma cells, the authors found that the P2Y6 receptor is highly selective for UDP over UTP.PMID:8700127
no obvious correlation was found between the expression of P2Y6 and breast cancer cell proliferationPMID:22558990
Report role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women.PMID:21898410
P2Y(6) receptor signaling pathway may be a potential therapeutic target for MSU-associated inflammatory diseases, such as tophaceous gout.PMID:22102722
P2Y6 receptor transgene is an important endogenous inhibitor of T cell function in mice with allergic pulmonary inflammationPMID:21724990
human microvascular endothelia exposed to inflammatory stimuli, followed by measurements of P2Y or P2X transcriptional responses, showed a selective induction of the P2Y(6) receptorPMID:21173118
activation of P2Y6 receptor mediates the UVB-radiation-induced activation of p38 MAPK and expression of COX-2PMID:21388279
P2Y6 receptors and ADAM17 mediates the low-dose gamma-radiation-induced activation of EGFR.PMID:21268712
modulation of human cavernosal smooth muscle relaxation can be achieved by activation of the P2Y6 receptor via non-neuronal and non-NO-dependent mechanisms, reinforcing the possible involvement of purinergic signalling in the erectile processPMID:17971163
hypertonic stress increases T cell interleukin-2 expression through a mechanism that involves ATP release, P2 receptor, and p38 MAPK activationPMID:12464620
P2Y(6) receptors interact rapidly with the TNF alpha-related intracellular signals to prevent apoptotic cell death.PMID:12623123
P2Y6 receptors highly responsive to UDP are endogenously expressed in human neuroblastoma SK-N-BE(2)C cells and they are involved in modulation of phospholipase C-coupled receptor-mediated Ca2+ mobilization by depleting the IP3-sensitive Ca2+ storesPMID:12716436
findings expand the pro-inflammatory biology of UDP mediated by the P2Y6 receptorPMID:15796906
P2Y receptors revealed that the P2Y6 (ligand of UDP) signaling pathway plays a predominant role in mediating human neutrophil peptides-induced IL-8 production.PMID:16322472
inotropic effects of UDP, mediated by P2Y6 receptorsPMID:16543499
on/off effect of IL-13 on P2Y(6)-induced Cl-secretion may help to identify the molecular determinants responsible for the CaCC channel activityPMID:17762175
P2Y6 receptor expression is increased by the stress-associated inflammatory response of Caco-2 intestinal epithelial cells.PMID:18250478
These results indicate that activation of Galpha(12/13) in cardiomyocytes by the extracellular nucleotides-stimulated P2Y(6) receptor triggers fibrosis in pressure overload-induced cardiac fibrosisPMID:19008857
P2Y agonists stimulate Ca(2+)-dependent Cl(-) secretion across human bronchial epithelia and that the cAMP/PKA pathway regulates apical but not basolateral P2Y(6) receptor-coupled ion transport in human bronchial epitheliaPMID:19011163
Human mast cells express uridine diphosphate-selective P2Y6 receptors that cooperate with type 1 cysteinyl-leukotriene receptors to promote cell survival and chemokine generation by a pathway involving reciprocal ligand-mediated cross-talk.PMID:19124756