MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYL KNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRY YKIVKPLWTSFIQSVSYSKLLSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELG RKWHKASNYIFVAIFWIVFLLLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVF VFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
Gene References into Functions
P2Y14R is downregulated in hCPCs derived from heart failure patients. Augmenting P2Y14R expression levels in aged/diseased hCPCs antagonizes senescence and improves functional responses.PMID:28980705
Present study suggests that P2Y14 expression could be used as a phenotypic marker to further dissect placental HSPCs.PMID:28804125
Data show that thymidine 5'-O-monophosphorothioate (TMPS) diminished UDPG-evoked intracellular calcium mobilization in a stable HEK293T cell line overexpressing the P2Y14 receptor.PMID:27732965
UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2.PMID:24847057
PPTN as a highly selective high-affinity antagonist of the P2Y14-R.PMID:23592514
These results support the notion that UDP-glucose is a stable and potent proinflammatory mediator that promotes P2Y(14)-R-mediated neutrophil motility via Rho/Rho kinase activation.PMID:22673622
The IUPHAR Subcommittee for P2Y receptor nomenclature and classification reviews the current knowledge of the UDP-glucose receptor and presents reasons for including it in the P2Y receptor family as the P2Y(14) receptor.PMID:12559763
a G-protein-coupled receptor identifying a quiescent, primitive population of hematopoietic cells restricted to bone marrow; it mediates primitive cell responses to specific hematopoietic microenvironmentsPMID:12842911
Discrete expression of GPR105 demonstrated within the immature subset of monocyte-derived dendritic cells (DC) suggests a possible role for this receptor in DC activation.PMID:12902497
We have demonstrated the presence of P2Y(14) receptor protein in platelets, but no contribution of this receptor to several measures of platelet function has been observedPMID:18690346
UDP-glucose stimulated IL-8 production via P2RY14 in human endometrial epithelial cells but not stromal cellsPMID:19454705
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.