MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVLFFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFYFTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKCSFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Gene References into Functions
Downregulation of the P2Y12 receptor in the superior cervical ganglia after myocardial ischemia may improve cardiac function by alleviating the sympathoexcitatory reflexPMID:28949406
TRAP-6 induced platelet activation leads to an elevation of purinergic receptor P2Y12 expression.PMID:29902630
upon platelet activation with ADP, the number of GP IIb-IIIa and P2Y12 receptors increases, which may serve as evidence of these proteins being synthesized in the activated plateletsPMID:27028818
In patients with type 2 diabetes, the presence of chronic kidney disease is associated with hyperreactive platelets and a dysfunctional status of the P2Y12 receptor signalling pathway.PMID:27786340
We documented a different effect of CYP2C19 and P2Y12 receptor polymorphisms on platelet reactivity and cardiovascular outcome in coronary artery disease patients after percutaneous coronary intervention on clopidogrel treatment. Importantly, increased platelet reactivity adversely affects the cardiovascular outcome independently of the studied polymorphisms.PMID:28329746
Findings offer insight into positive regulation of Akt signaling through P2Y12 phosphorylation as well as MAPK signaling in platelets by ASK1.PMID:28753204
Genomic association study identified deleterious rare variants in P2RY12 in patients with ischemic stroke.PMID:29232918
Expression of platelet hsa-miR-223 increased and P2RY12 mRNA reduced in type 2 diabetic patients following ET non-significantly.PMID:29526844
The meta-analysis shows a potential of association between P2RY12 gene polymorphisms and higher risks of composite ischemic events for coronary artery disease patients treated with clopidogrel. [review]PMID:29510176
CLEC-2 and P2Y12 are required for CpG ODN-induced platelet activation and thrombosis, and might be targeted to prevent adverse events in patients at risk.PMID:28296036
miR-223, miR-26b, miR-126 and miR-140 are expressed at a lower level in platelets and megakaryocytes in type 2 diabetics causing up-regulation of P2RY12 and SELP mRNAs that may contribute to adverse platelet function.PMID:27975100
The DHA - naringenin hybrid presented triple antiplatelet activity simultaneously targeting PAR-1, P2Y12 and COX-1 platelet activation pathwaysPMID:28844979
The results suggest that P2Y12 is a useful marker for the identification of human microglia throughout the lifespan. Moreover, P2Y12 expression might help to discriminate activated microglia and infiltrating myeloid cells from quiescent microglia in the human CNS.PMID:27862351
P2RY12, the gene related to thrombogenesis was differentially expressed between the left atrium and right atrium in Sinus rhythm and Atrial fibrillation. Therefore, the changes in the expression of these genes were likely involved in the pathophysiology of AF-related thrombus formation.PMID:27494721
Abnormalities of P2Y12 receptor include congenital deficiencies or high activity in diseases like diabetes mellitus and chronic kidney disease, exposing such patients to a prothrombotic condition. (Review)PMID:27628007
Data suggest that PAR4 and P2Y12 heterodimer internalization/endocytosis is required for beta-arrestin-2 recruitment to endosomes and up-regulation of Akt signaling; activation of PAR4 but not of P2Y12 drives internalization of the PAR4-P2Y12 heterodimer. (PAR4 = protease-activated receptor 4; P2Y12 = purinergic receptor P2Y, G-protein coupled, 12 protein; Akt = proto-oncogene protein c-akt)PMID:28652403
Studies indicate that purinergic receptor P2Y12 (P2Y12 receptor) gene C34T and G52T polymorphism might be a risk factor for the poor response to the platelet in patients on clopidogrel therapy.PMID:28791856
studies describe 2 novel modes of action of ticagrelor, inhibition of platelet ENT1 and inverse agonism at the P2Y12R that contribute to its effective inhibition of platelet activation.PMID:27694321
apart from the established association of the CYP2C19 *2 and *3 LOF alleles with high on-treatment platelet reactivity (HTPR), haplotypes of P2RY12 rs6798347, rs6787801, rs6801273, and rs6785930 rather than rs2046934 (T744C) that related to pharmacodynamics of clopidogrel in patients with ACS were independently associated with HTPRPMID:28070995
The present report illustrates an update of dysfunctional platelet P2Y12R mutations diagnosed with congenital lifelong bleeding problems. [review]PMID:27487748
aim of this study was to evaluate the effects of platelet receptor gene (P2Y12, P2Y1) and glycoprotein gene (GPIIIa) polymorphisms, as well as their interactions, on antiplatelet drug responsiveness and clinical outcomes in patients with acute MISPMID:28091702
The Conundrum of Platelet P2Y12 Inhibition in ST-Segment Elevation Myocardial Infarction.PMID:27795489
P2Y12R gene rs2046934 C>T and rs3732759 A>G polymorphisms might be associated with the risk of coronary artery disease and the efficacy of clopidogrel treatment for CAD.PMID:27566695
No association was found in genotype frequencies of P2Y12 and responsiveness to clopidogrel in coronary heart disease patients of Han ethnicity.PMID:27488401
P2Y12 inhibitor monotherapy and dual antiplatelet therapy inhibit hemostatic system activation to a comparable extent in healthy volunteers.PMID:26663880
In the presence of loss of function C34T polymorphism of P2Y12 receptor, smoking is associated with increased adverse cardiovascular outcome in coronary artery disease patients.PMID:26950170
These data strongly suggest that P2Y12 may represent an important pharmacological target for the treatment of patients with allergic bronchial asthma. [review]PMID:25579761
Report appropriate P2Y12 inhibitor regimen to prevent increased bleeding risk and maintain antiplatelet efficacy in East Asian patients with acute coronary syndrome. in Korean patientsPMID:26354056
Baseline platelet aggregation was increased in carriers of the common alleles of P2Y12 SNPs rs1907637, rs2046934, and rs6809699 and rs6787801 TC heterozygotes.PMID:26083990
The ratio of ADP- to TRAP-induced platelet aggregation quantifies P2Y12-dependent platelet inhibition independently of the platelet count in contrast to conventional ADP-induced aggregation.PMID:26885820
Synergistic inhibition of both P2Y1 and P2Y12 adenosine diphosphate receptors by GLS-409 immediately attenuates platelet-mediated thrombosis and effectively blocks agonist-stimulated platelet aggregation irrespective of concomitant aspirin therapy.PMID:26743169
PON1, P2Y12 and COX1 polymorphisms were associated with poorer vascular outcomes in patients with extracranial or intracranial stents.PMID:26870959
In non-ST elevation acute coronary syndrome patients undergoing PCI a loading dose of ticagrelor or prasugrel given during the procedure provides optimal P2Y12-ADP receptor blockade in 2 h and maximal inhibition within 4 h.PMID:26311415
While there is increasing evidence for the cancer-protective effect of aspirin, this study suggests P2Y12 inhibition may also play a role.PMID:26353776
Establish a reliable antiplatelet profile of SAR216471, and support its potential use in clinical practice as an alternative to currently available P2Y12 receptor antagonists.PMID:25064036
2 functional single nucleotide polymorphisms of PON1 gene (rs662 and rs854560) and 3 variants of the P2RY12 gene (rs2046934, rs6798347, rs6801273) in samples pooled from average Hungarian Roma and Hungarian population samples, were investigated.PMID:25297118
coexisting polymorphisms of CYP3A5*3 and 2C19*2, but not P2Y12*1, play an important role in the variability of clopidogrel's curative effectPMID:25730082
ADP stimulation of P2Y12 led to cAMP decrease that, in turn, caused changes in phospholipase C phosphorylation by protein kinase A, increase in cytoplasmic calcium level and, consequently, PS+ platelet formationPMID:26391841
Leukotriene E4 may play some important roles in allergic mucus secretion partially via activation of P2Y12 receptorPMID:25838093
the distribution of the ABCB1, CYP3A5, CYP2C19, and P2RY12 gene polymorphisms distinguishes to the Mexican Mestizos population from other ethnic groups.PMID:25106522
Experiments reveal a surmountable and competitive mode of antagonism of ticagrelor at P2Y12 -receptors activated by either the natural agonist ADP or the synthetic agonist 2-methylthio-ADP.PMID:25186974
This is the first study to demonstrate that the genetic polymorphisms of P2RY12 can affect platelet and eosinophil activation in patients with aspirin-exacerbated respiratory disease after aspirin exposure.PMID:25778862
this is the first study to report that PJ34 could act via a competitive P2Y(12) antagonism.PMID:25329809
Our findings suggest that the regulation of gpiibiiia and P2Y12 levels could be clinically useful to activate platelets to reach hemostasis.PMID:25247182
The findings of this study suggest a potential association between P2Y12-receptor H2/H2 carriers and reduced platelet function mediated by TRAP in healthy volunteers.PMID:24510678
study reports robust involvement of P2Y12R in inflammatory pain: anti-hyperalgesic effect of P2Y12R antagonism could be mediated by the inhibition of both central and peripheral cytokine production and involves alpha7-receptor mediated efferent pathwaysefferent pathwaysPMID:24971933
Two patients with bleeding diathesis had dysfunctional platelet P2Y12 receptor for ADP, attributable to homozygous His187Gln mutation.PMID:25428217
thrombin activates the mTORC1 pathway in human platelets through PKC-mediated ADP secretion and subsequent activation of P2Y(12), in a manner largely independent of the canonical PI3 kinase/Akt pathwayPMID:24612393
analysis of a P2Y12 receptor mutation and a function-reducing polymorphism in protease-activated receptor 1 in a patient with chronic bleeding [case report]PMID:24612435
The evidence from our study indicates that P2Y12 methylation may bring new hints to elaborate the pathogenesis of CR.PMID:24745016
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.