Home
Product
Protein
Transmembrane Proteins
Recombinant Human Oxoeicosanoid receptor 1 (OXER1)

Recombinant Human Oxoeicosanoid receptor 1 (OXER1)

Code: CSB-CF837442HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5660

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OXER1

Uniprot NO.

Q8TDS5

Alternative Names

OXER1; GPR170; TG1019; Oxoeicosanoid receptor 1; 5-oxo-ETE G-protein coupled receptor; G-protein coupled receptor 170; G-protein coupled receptor R527; G-protein coupled receptor TG1019

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-423

Target Protein Sequence

MLCHRGGQLIVPIIPLCPEHSCRGRRLQNLLSGPWPKQPMELHNLSSPSPSLSSSVLPPS FSPSPSSAPSAFTTVGGSSGGPCHPTSSSLVSAFLAPILALEFVLGLVGNSLALFIFCIH TRPWTSNTVFLVSLVAADFLLISNLPLRVDYYLLHETWRFGAAACKVNLFMLSTNRTASV VFLTAIALNRYLKVVQPHHVLSRASVGAAARVAGGLWVGILLLNGHLLLSTFSGPSCLSY RVGTKPSASLRWHQALYLLEFFLPLALILFAIVSIGLTIRNRGLGGQAGPQRAMRVLAMV VAVYTICFLPSIIFGMASMVAFWLSACRSLDLCTQLFHGSLAFTYLNSVLDPVLYCFSSP NFLHQSRALLGLTRGRQGPVSDESSYQPSRQWRYREASRKAEAIGKLKVQGEVSLEKEGS SQG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid. Seems to be coupled to the G(i)/G(o), families of heteromeric G proteins.

Gene References into Functions

These findings verify that membrane-acting androgens exert specific effects through an antagonistic interaction with OXER1. Additionally, this interaction between androgen and OXER1, which is an arachidonic acid metabolite receptor expressed in prostate cancer, provides a novel link between steroid and lipid actions and renders OXER1 as new player in the disease. PMID:28290516
membrane receptor OxeR1 is involved in StAR protein induction and activation of steroidogenesis triggered by cAMP or angiotensin II, acting, at least in part, through ERK1/2 activation. PMID:25657046
Gue1654 as a non-Galphai-biased antagonist of OXE-R that provides a new basis for therapeutic intervention in inflammatory diseases that involve activation of eosinophils, neutrophils, and monocytes. PMID:24733850
OXER1 has a role in regulating the survival-promoting effects of arachidonate 5-lipoxygenase in prostate cancer cells PMID:23643940
Identification of a novel human receptor coupled to G(i/o). PMID:12065583
identification and cloning of a novel GPCR, R527; 5-oxo-ETE was identified as the ligand for R527; very high level of mRNA expression in eosinophils with high expression also detected in neutrophils and lung macrophages PMID:12606753
5-oxoER is critical for prostate cancer cell survival. PMID:16289380

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in various tissues except brain. Expression is more intense in liver, kidney, peripheral leukocyte, lung, and spleen than in other tissues. Highly expressed in eosinophils, neutrophils, and lung macrophages.

Database Links

HGNC: 24884

UNIGENE: Hs.168439

KEGG: hsa:165140

STRING: 9606.ENSP00000367930

Promotions