Recombinant Human Oxidized low-density lipoprotein receptor 1 (OLR1)

Code: CSB-CF016331HU
Size:
20μg
20μg100μg
US$4537
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
OLR1
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-273
Target Protein Sequence
MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor that mediates the recognition, internalization and degradation of oxidatively modified low density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL is a marker of atherosclerosis that induces vascular endothelial cell activation and dysfunction, resulting in pro-inflammatory responses, pro-oxidative conditions and apoptosis. Its association with oxLDL induces the activation of NF-kappa-B through an increased production of intracellular reactive oxygen and a variety of pro-atherogenic cellular responses including a reduction of nitric oxide (NO) release, monocyte adhesion and apoptosis. In addition to binding oxLDL, it acts as a receptor for the HSP70 protein involved in antigen cross-presentation to naive T-cells in dendritic cells, thereby participating in cell-mediated antigen cross-presentation. Also involved in inflammatory process, by acting as a leukocyte-adhesion molecule at the vascular interface in endotoxin-induced inflammation. Also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells and both Gram-negative and Gram-positive bacteria.
Gene References into Functions
  1. Study showed that a high expression of LOX-1 was associated with poor prognosis in gastric cancer (GC) patients and TNM stage. LOX-1 was found to promote migration, invasion and epithelial-mesenchymal transition (EMT) of GC cells through activating PI3K/Akt/GSK3beta pathway. PMID:28345638
  2. LOX-1(+) CD15(+) polymorphonuclear myeloid-derived suppressor cells were elevated in hepatocellular carcinoma patients and suppressed T cell proliferation through ROS/Arg I pathway induced by ER stress. PMID:29211299
  3. High LOX-1 ligand activity as a risk factor for ischemic stroke. PMID:28442661
  4. The analysis also revealed that OLR1 is not required for the transcriptional regulation induced by oxidized PAPC but interestingly, OLR1 knockdown affected expression of CNN2, HMRR, ITGB6 and KIF20A, all genes governing cell proliferation and motility. PMID:29103984
  5. Data show that oxidized low density lipoprotein receptor 1 (LOX-1) is overexpressed in prostate cancer cells. PMID:29107109
  6. expression significantly higher in the arterial wall of epicardial coronary arteries compared to intramyocardial coronary arteries PMID:29448251
  7. let7g exerts a LOX1independent antiaging effect on endothelial cells. PMID:29393358
  8. high LOX-1 expression in pancreatic cancer tissues is indicative for the occurrence of lymph node metastases, high TNM stages and a poor prognosis. PMID:29168159
  9. lincRNAp21 is a major mediator of oxLDLinduced apoptosis and expression of LOX1 in human vascular endothelial cells, and acts via activation of PKCdelta. PMID:28983628
  10. this study shows that LOX-1 is involved in IL-1beta production and extracellular matrix breakdown in dental peri-implantitis PMID:28898769
  11. Results showed that the scFv with N-terminal fusing peptides proteins demonstrated increased LOX-1-binding activity without decrease in stability. These findings will help increase the application efficacy of LOX-1 targeting scFv in LOX-1-based therapy PMID:29094051
  12. The serum sLOX-1 level was higher in patients with large artery atherosclerotic stroke, and it was an independent predictor of functional outcome in patients with large artery atherosclerotic ischemic stroke. PMID:27967338
  13. LOX-1 has a role in atherogenesis and tumorigenesis as a potential link in these diseases [review] PMID:29462603
  14. the rs1050283 T allele of LOX-1 is strongly associated with an increased risk for atherosclerotic cerebral infarction in a Chinese population, which also affects levels of LOX-1 and sLOX-1 PMID:27840386
  15. data revealed that miR-let-7g exhibits anti-atherosclerotic activity, at least partially by targeting the LOX-1 signaling pathway. PMID:28535009
  16. High LOX1 expression is associated with colorectal cancer. PMID:26895376
  17. Increased LOX-1 expression in endothelial cells is potentially involved in the pathogenesis of sickle cell disease vasculopathy PMID:27519944
  18. LOX-1 signalling and the crucial role of cytokines PMID:28860004
  19. High OLR1 expression is associated with breast cancer. PMID:28844714
  20. Multiple classical molecular dynamics simulations have been applied to the human LOX-1 receptor to clarify the role of the Trp150Ala mutation in the loss of binding activity. Results indicate that the substitution of this crucial residue, located at the dimer interface, markedly disrupts the wild-type receptor dynamics PMID:28657156
  21. Carrying the C allele of the rs11053646 variant of the OLR1 gene was associated with an increased risk of CAD in heterozygous adult patients with FH, and this risk could be even greater in smokers as well as in younger patients. PMID:28941610
  22. Berberine could prevent the oxLDL and TNFalpha - induced LOX1 expression and oxidative stress, key events that lead to NOX, MAPK/Erk1/2 and NF-kappaB activation linked to endothelial dysfunction. PMID:28511903
  23. Individuals >/=30 years old with abdominal obesity presented lower Lox1 levels than patients >/=30 years old without abdominal obesity. PMID:27525284
  24. These studies suggest that activation of LOX-1 expression occurs through binding of the chlamydial glycan and provides one mechanism by which Chlamydia pneumoniae infection could play a role in the pathogenesis of atherosclerosis. PMID:23821487
  25. Elevated LOX1 is Associated with Acute Stroke. PMID:27025681
  26. Xanthine oxidase induces foam cell formation in large part through activation of LOX-1 - NLRP3 pathway in both vascular smooth muscle cells and THP-1 cells. PMID:28084571
  27. show that MiR-590-5p inhibits angiogenesis by targeting LOX-1 and suppressing redox-sensitive signals PMID:26932825
  28. OLR1 rs1050286 SNP may contribute to modify OLR1 susceptibility to acute myocardial infarction and coronary artery diseases. PMID:26542080
  29. Serum sLOX-1 level was significantly lower in the restless legs syndrome patient group compared to controls. PMID:27546362
  30. The mechanistic link between miR-590-5p and LOX-1:miR-590-5p downregulation led to LOX-1 upregulation in endothelial cells. PMID:26906623
  31. Serum LAB was associated with an increased carotid IMT in Japanese men, especially those with hypercholesterolemia PMID:26892134
  32. the current meta-analysis highlighted that variant allele of OLR1 rs11053646 G > C and PCSK9 rs505151 A > G may contribute to the susceptibility risk of ischemic stroke. PMID:26666837
  33. Silencing of LOX-1 gene expression abolished ox-LDL induced effects in cell viability, reactive oxygen species generation and gene expression. PMID:26510581
  34. both the 501>C single nucleotide polymorphisms in the LOX1 gene and the serum LOX1 level may be used to predict the development of left ventricular hypertrophy among essential hypertension patients. PMID:24480971
  35. for our Turkish sample group, LOX-1 30UTR188C/T and K167N polymorphisms may not be involved in susceptibility to GDM [gestational diabetes mellitus ] PMID:26296941
  36. Cholesterol depletion triggers the release of LOX-1 in exosomes as a full-length transmembrane isoform and as a truncated ectodomain soluble fragment. PMID:26495844
  37. Interaction between Lox-1, C-reactive protein and oxidized LDL play role in the pathogenesis of atherosclerosis. PMID:26607724
  38. OLR1 is a novel molecular link between the proliferative and inflammatory responses of vascular smooth muscle cells. PMID:26305474
  39. Ginkgo biloba extract inhibits oxLDL-induced matrix metalloproteinase activation by the modulation of the LOX1-regulated signaling pathway in human umbilical vein endothelial cells. PMID:25080882
  40. Data show that the interplay between the two TNF receptors (TNFR1 and TNFR2) was apparent in the expression pattern of lectin-type oxidized LDL receptor 1 (LOX-1) in response to TNF-alpha. PMID:25416967
  41. The serum LOX-1 levels were significantly higher in NAFLD patients than in healthy controls. PMID:26185381
  42. Low shear stress is a regulator of autophagy and LOX-1 plays an important role in shear stress induced autophagy. PMID:25697875
  43. results showed higher expression of HSP70 and LOX-1 in the placental tissues of pre-eclampsia patients which represent the possible contribution of these molecules in the disease pathogenesis. PMID:24786389
  44. Elevated plasma sLOX-1 level on admission independently predicts long-term all-cause mortality and MACE after STEMI. PMID:25746549
  45. biomarker for determining early endothelial damage in hypertension, especially in white coat hypertension PMID:25007999
  46. LOX-1 activation by oxLDL is an important event that enhances tumor angiogenesis PMID:25170920
  47. LOX-1 is the receptor that mediates oxidized LDL activity in vascular endothelial cells.Activation of LOX-1 causes endothelial dysfunction and vascular lipid deposition. PMID:25463747
  48. Our data indicate a new direction for LOX-1 regulation by the modulation of the PKCbeta/NAPDH oxidase/SIRT1/HSF1 mechanism PMID:25982096
  49. The present study showed that circulating soluble LOX-1 originates from coronary circulation and soluble LOX-1 and LOX-1 index are useful biomarkers for acute coronary syndrome. PMID:24895597
  50. Meta-analysis results showed that the +1073 C/T polymorphism in ORL1 decreased the risk of Alzheimer's disease. This allele was predicted to affect the binding site of many miRNAs explaining the relationship between the +1073 C/T variant and the disease. PMID:25501227

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted. Note=A secreted form also exists. Localization to membrane rafts requires palmitoylation.
Tissue Specificity
Expressed at high level in endothelial cells and vascular-rich organs such as placenta, lung, liver and brain, aortic intima, bone marrow, spinal cord and substantia nigra. Also expressed at the surface of dendritic cells. Widely expressed at intermediate
Database Links

HGNC: 8133

UNIGENE: Hs.412484

KEGG: hsa:4973

STRING: 9606.ENSP00000309124

OMIM: 602601

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products