Recombinant Human Opsin-3 (OPN3)-VLPs

Code: CSB-MP872435HU

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

Pls inquire

Quantity:

Express system: Mammalian cell

Species: Homo sapiens (Human)

Tag Info: C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OPN3

Uniprot NO.

Q9H1Y3

Research Area

Neuroscience

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-402aa

Target Protein Sequence

MYSGNRSGGHGYWDGGGAAGAEGPAPAGTLSPAPLFSPGTYERLALLLGSIGLLGVGNNLLVLVLYYKFQRLRTPTHLLLVNISLSDLLVSLFGVTFTFVSCLRNGWVWDTVGCVWDGFSGSLFGIVSIATLTVLAYERYIRVVHARVINFSWAWRAITYIWLYSLAWAGAPLLGWNRYILDVHGLGCTVDWKSKDANDSSFVLFLFLGCLVVPLGVIAHCYGHILYSIRMLRCVEDLQTIQVIKILKYEKKLAKMCFLMIFTFLVCWMPYIVICFLVVNGHGHLVTPTISIVSYLFAKSNTVYNPVIYVFMIRKFRRSLLQLLCLRLLRCQRPAKDLPAAGSEMQIRPIVMSQKDGDRPKKKVTFNSSSIIFIITSDESLSVDDSDKTNGSKVDVIQVRPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Tag Info

C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin. Binds both 11-cis retinal and all-trans retinal. Regulates melanogenesis in melanocytes via inhibition of alpha-MSH-induced MC1R-mediated cAMP signaling, modulation of calcium flux, regulation of CAMK2 phosphorylation, and subsequently phosphorylation of CREB, p38, ERK and MITF in response to blue light. Plays a role in melanocyte survival through regulation of intracellular calcium levels and subsequent BCL2/RAF1 signaling. Additionally regulates apoptosis via cytochrome c release and subsequent activation of the caspase cascade. Required for TYR and DCT blue light-induced complex formation in melanocytes. Involved in keratinocyte differentiation in response to blue-light. Required for the UVA-mediated induction of calcium and mitogen-activated protein kinase signaling resulting in the expression of MMP1, MMP2, MMP3, MMP9 and TIMP1 in dermal fibroblasts. Plays a role in light-mediated glucose uptake, mitochondrial respiration and fatty acid metabolism in brown adipocyte tissues. May be involved in photorelaxation of airway smooth muscle cells, via blue-light dependent GPCR signaling pathways.

Gene References into Functions

Decreased OPN3 levels in Bel7402(5-FU) cells activated the anti-apoptotic pathway through increasing phospho-Akt and the Bcl2/Bax ratio, while overexpression of OPN3 inactivated this pathway. PMID:22313545
Assignment of panopsin (OPN3) to human chromosome band 1q43 PMID:12063405
Human OPN3 gene consists of six exons and expresses various splice variants. PMID:12242008
Polymorphisms in the OPN3 and CHML genes are associated with asthma and atopic asthma. PMID:18344558
Related persons with heterozygous germline deletions of 1q42.3, which includes EXO1, RGS7, KMO, CHML, and OPN3, showed no phenotypic abnormalities other than multiple leiomyomatosis. PMID:14623461

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cytoplasm.

Protein Families

G-protein coupled receptor 1 family, Opsin subfamily

Tissue Specificity

Expressed in tracheal airway smooth muscle (at protein level). Expressed throughout the epidermis and dermis, predominantly in the basal layer on the facial and abdominal skin (at protein level). Expressed in dermal fibroblasts (at protein level). Express

Database Links

HGNC: 14007

UNIGENE: Hs.409081

KEGG: hsa:23596

STRING: 9606.ENSP00000355512

OMIM: 606695

Promotions