Home
Product
Protein
Transmembrane Proteins
Recombinant Human Olfactory receptor 51E2 (OR51E2)

Recombinant Human Olfactory receptor 51E2 (OR51E2)

Code: CSB-CF861998HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4889

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OR51E2

Uniprot NO.

Q9H255

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-320

Target Protein Sequence

MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDLQAVGGK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Olfactory receptor. Activated by the odorant, beta-ionone, a synthetic terpenoid. The activity of this receptor is propably mediated by G-proteins leading to the elevation of intracellular Ca(2+), cAMP and activation of the protein kinases PKA and MAPK3/MAPK1. Stimulation of OR51E2 by beta-ionone affects melanocyte proliferation, differentiation, and melanogenesis. Activation of OR51E2 by beta-ionone increases proliferation and migration of primary retinal pigment epithelial (RPE) cells. Activated also by the short-chain fatty acids (SCFA) acetate and propionate. In response to SCFA, may positively regulate renin secretion and increase blood pressure. May also be activated by steroid hormones and regulate cell proliferation. Activated by L-lactate in glomus cells.

Gene References into Functions

Strikingly, OR51E2 was the most highly enriched OR transcript mapped to the human olfactome in lung-resident cells. In a heterologous expression system, OR51E2 trafficked readily to the cell surface and showed ligand selectivity and sensitivity to the short chain fatty acids (SCFAs) acetate and propionate. PMID:27905542
OR51E2 is involved in the regulation of cell proliferation and migration in human primary melanoma and melanoma metastasis PMID:28191688
Two genes, OR51E2 and SIM2, and two miRNAs, miR-200c and miR-200b, showed significant association with prostate cancer. PMID:28910345
Plasma membrane preparations showed that OR51E2 protein is present at the melanocyte cell surface. PMID:27226631
PSGR overexpression synergizes with loss of PTEN to accelerate prostate cancer development, and present a novel bigenic mouse model that mimics the human condition PMID:26028029
Pyk2-NDRG1 axis is possibly involved in conveying the anti-proliferative effect of beta-ionone in prostate cancer cells. PMID:25219547
Increased expression of prostate-specific G-protein-coupled receptor is associated with prostate intraepithelial neoplasia and prostate cancers PMID:15499628
two functional promoters regulate the transcriptional expression of PSGR in human prostate tissues, and PSGR is a new target for IL-6 transcriptional regulation PMID:16149059
PSGR overexpression is associated with higher percentage of pathologic stage, pT3, and a higher level of preoperative serum PSA in Prostate Cancer PMID:16231015
expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevated PMID:16491480
We identified androstenone derivatives as ligands for the recombinant receptor PSGR PMID:19389702

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Highly expressed in the prostate. Also expressed in spleen, liver, olfactory epithelium, retinal pigment epithelium and medulla oblongata. In the retinal pigment epithelium expression is restricted to the pigment cells and choroid (at protein level). Expr

Database Links

HGNC: 15195

UNIGENE: Hs.501758

KEGG: hsa:81285

STRING: 9606.ENSP00000380153

OMIM: 611268

Promotions