MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDLQAVGGK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Olfactory receptor. Activated by the odorant, beta-ionone, a synthetic terpenoid. The activity of this receptor is propably mediated by G-proteins leading to the elevation of intracellular Ca(2+), cAMP and activation of the protein kinases PKA and MAPK3/MAPK1. Stimulation of OR51E2 by beta-ionone affects melanocyte proliferation, differentiation, and melanogenesis. Activation of OR51E2 by beta-ionone increases proliferation and migration of primary retinal pigment epithelial (RPE) cells. Activated also by the short-chain fatty acids (SCFA) acetate and propionate. In response to SCFA, may positively regulate renin secretion and increase blood pressure. May also be activated by steroid hormones and regulate cell proliferation. Activated by L-lactate in glomus cells.
Gene References into Functions
Strikingly, OR51E2 was the most highly enriched OR transcript mapped to the human olfactome in lung-resident cells. In a heterologous expression system, OR51E2 trafficked readily to the cell surface and showed ligand selectivity and sensitivity to the short chain fatty acids (SCFAs) acetate and propionate.PMID:27905542
OR51E2 is involved in the regulation of cell proliferation and migration in human primary melanoma and melanoma metastasisPMID:28191688
Two genes, OR51E2 and SIM2, and two miRNAs, miR-200c and miR-200b, showed significant association with prostate cancer.PMID:28910345
Plasma membrane preparations showed that OR51E2 protein is present at the melanocyte cell surface.PMID:27226631
PSGR overexpression synergizes with loss of PTEN to accelerate prostate cancer development, and present a novel bigenic mouse model that mimics the human conditionPMID:26028029
Pyk2-NDRG1 axis is possibly involved in conveying the anti-proliferative effect of beta-ionone in prostate cancer cells.PMID:25219547
Increased expression of prostate-specific G-protein-coupled receptor is associated with prostate intraepithelial neoplasia and prostate cancersPMID:15499628
two functional promoters regulate the transcriptional expression of PSGR in human prostate tissues, and PSGR is a new target for IL-6 transcriptional regulationPMID:16149059
PSGR overexpression is associated with higher percentage of pathologic stage, pT3, and a higher level of preoperative serum PSA in Prostate CancerPMID:16231015
expression of PSGR and PSGR2 relative to AMACR in prostate cancer; AMACR was the most overexpressed, but in some cases expression of AMACR was not significantly elevated while PSGR and/or PSGR2 were substantially elevatedPMID:16491480
We identified androstenone derivatives as ligands for the recombinant receptor PSGRPMID:19389702
Highly expressed in the prostate. Also expressed in spleen, liver, olfactory epithelium, retinal pigment epithelium and medulla oblongata. In the retinal pigment epithelium expression is restricted to the pigment cells and choroid (at protein level). Expr