Home
Product
Protein
Transmembrane Proteins
Recombinant Human Olfactory receptor 2L13 (OR2L13)

Recombinant Human Olfactory receptor 2L13 (OR2L13)

Code: CSB-CF822694HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4829

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OR2L13

Uniprot NO.

Q8N349

Alternative Names

OR2L13; OR2L14; Olfactory receptor 2L13; Olfactory receptor 2L14

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-312

Target Protein Sequence

MEKWNHTSNDFILLGLLPPNQTGIFLLCLIILIFFLASVGNSAMIHLIHVDPRLHTPMYF LLSQLSLMDLMYISTTVPKMAYNFLSGQKGISFLGCGVQSFFFLTMACSEGLLLTSMAYD RYLAICHSLYYPIRMSKMMCVKMIGGSWTLGSINSLAHTVFALHIPYCRSRAIDHFFCDV PAMLLLACTDTWVYEYMVFVSTSLFLLFPFIGITSSCGRVLFAVYHMHSKEGRKKAFTTI STHLTVVIFYYAPFVYTYLRPRNLRSPAEDKILAVFYTILTPMLNPIIYSLRNKEVLGAM RRVFGIFSFLKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Odorant receptor.

Gene References into Functions

RNA-Seq evidence of testis-specific monoallelic expression of OR2L13, located 419 kb downstream of the GCSAML somatic (secondary), imprinted differentially methylated region (iDMR). OR2L13 has a predicted CGI-bearing allelically methylated region overlapping the promoter region in blood, spleen, lung, liver, esophagus, and brain, but hypomethylated in gamete, blastocyst, placenta, thymus, and spinal cord methylomes. PMID:29545821
Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID:20379614

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Database Links

HGNC: 19578

UNIGENE: Hs.372936

KEGG: hsa:284521

STRING: 9606.ENSP00000350836

Promotions