Recombinant Human Olfactory receptor 1D2 (OR1D2)

Code: CSB-CF016490HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4829

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OR1D2

Uniprot NO.

P34982

Alternative Names

OR1D2; OLFR1; Olfactory receptor 1D2; Olfactory receptor 17-4; OR17-4; Olfactory receptor OR17-6; Olfactory receptor-like protein HGMP07E

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-312

Target Protein Sequence

MDGGNQSEGSEFLLLGMSESPEQQRILFWMFLSMYLVTVVGNVLIILAISSDSRLHTPVY FFLANLSFTDLFFVTNTIPKMLVNLQSHNKAISYAGCLTQLYFLVSLVALDNLILAVMAY DRYVAICCPLHYTTAMSPKLCILLLSLCWVLSVLYGLIHTLLMTRVTFCGSRKIHYIFCE MYVLLRMACSNIQINHTVLIATGCFIFLIPFGFVIISYVLIIRAILRIPSVSKKYKAFST CASHLGAVSLFYGTLCMVYLKPLHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL GRLLDKHFKRLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Odorant receptor which may be involved in sperm chemotaxis. Bourgeonal is a strong chemoattractant for sperm in vitro and is shown to be a strong agonist for OR1D2 in vitro. May also function in olfactory reception.

Gene References into Functions

The present preliminary study seems to confirm the important role of OR1D2 both in nose and spermatozoa and may explain the idiopathic infertility of the study group. PMID:23525651
the homo-oligomerization status of the human OR1740 receptor and its involvement in receptor activation upon odorant ligand binding were addressed PMID:21454689
results indicate that hOR17-4 functions in human sperm chemotaxis and may be a critical component of the fertilization process PMID:12663925

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Note=In spermatazoa is localized in the midpiece and is translocated to the head region upon receptor stimulation with bourgeonal.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in testis. Expressed in spermatozoa (at protein level). Expressed in olfactory epithelium.

Database Links

HGNC: 8183

UNIGENE: Hs.532771

KEGG: hsa:4991

STRING: 9606.ENSP00000327585

OMIM: 164342

Promotions