MSSRPLESPPPYRPDEFKPNHYAPSNDIYGGEMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLIIVMCIAIFACVASTLAWDRGYGTSLLGGSVGYPYGGSGFGSYGSGYGY GYGYGYGYGGYTDPRAAKGFMLAMAAFCFIAALVIFVTSVIRSEMSRTRRYYLSVIIVSA ILGIMVFIATIVYIMGVNPTAQSSGSLYGSQIYALCNQFYTPAATGLYVDQYLYHYCVVD PQEAIAIVLGFMIIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKN VSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPV DDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREY PPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADE YNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.; (Microbial infection) Acts as a co-receptor for hepatitis C virus (HCV) in hepatocytes.
Gene References into Functions
our findings for the first time identify the role of occludin as a tumor promoter and a prometastatic factor in lung cancer, demonstrating that occludin is a potential prognostic biomarker and therapeutic target in lung cancerPMID:29750300
Occludin protein may contribute to the development of cervical cancer. However, it was not correlated with the clinical features.PMID:29516973
Low occludin expression is associated with Renal cell carcinoma.PMID:28534944
decreased interaction between ZO-1 and occludin might contribute to the epiphora occurred in the transplanted submandibular glandsPMID:28332063
integration of claudin-2, occludin and ZO-1 is necessary for maintaining the function of the proximal tubular epithelium.PMID:29252987
Molecular studies of the OCLN gene (NM_001205254) identified six distinct candidate mutations in polymicrogyria.PMID:28179633
Glutamine increased claudin-1 expression in the colonic mucosa of patients with irritable bowel syndrome. In contrast, occludin expression was not significantly modified by glutamine.PMID:25972430
Endothelial cellsTLR4 strongly regulates retinal vessel permeability by reducing expression of occludin and zonula occludens 1.PMID:29136627
Viral infectivity was significantly reduced by miR-200c but enhanced by miR-122.PMID:28642978
The mechanism of transition from nondifferentiated to differentiated states in HepaRG cells was studed by proteomics. Two key factors (MMP-14 and OCLN) were validated by qRT-PCR and Western blot.PMID:27790907
Intracellular zinc has an essential role in the maintenance of the intestinal epithelial tight junction barrier through regulation of occludin proteolysis and claudin-3 transcription.PMID:27151944
Data suggest that long noncoding RNA PlncRNA1 and microRNA miR-34c bound together to regulate the expressions of MAZ, ZO-1 and occludin.PMID:28153728
Study provides evidence that occludin contributes to the regulation of size-reductive proliferation and epithelial cell maturation in a phosphorylation-dependent manner.PMID:27185880
Report shows that silencing MARCH3 protects the endothelial barrier and upregulates OCLN in MARCH3-depleted cells. MARCH3 silencing results in the strengthening of cell-cell contacts and inactivates FoxO1.PMID:27616439
STAT3 activation downregulates the ZO-1 and occludin levels and increases the endothelial permeability through the induction of VEGF production in retinal endothelial cells.PMID:27580405
Downregulation of OCLN is associated with clear cell renal cell carcinoma.PMID:28184927
These data suggest that the Rho/ROCK signaling pathway is involved in HIV-1 Tat-mediated changes in occludin, RAGE, and LRP1 in human cerebral microvascular endothelial cells cells.PMID:27563375
OCLN is essential for HCV infection of human hepatic cells.PMID:26887345
OCLN and ZO1 levels appear to be early prognostic markers in patients suffering from sepsis.PMID:26863122
autotypic tight junctions molecular composition, like claudin-1 and occludin expression could influence the demyelinating process by altering the permeability of the blood-nerve barrier.PMID:26662145
Occludin expression has a clear relationship with bone metastasis in human cancer.PMID:26977027
This is report of a family of Indian origin with two affected sibs and segregation of a homozygous novel OCLN mutation in the exon 3(NG_028291.1(OCLN_v001):c.252delC).PMID:26689621
Data show that estrogen mediates control of hepatitis C virus through the G-protein-coupled estrogen receptor 30 (GPR30) pathway leading to cleavage of occludin by Matrix Metalloproteinase-9 (MMP-9).PMID:26731262
In hepatitis C virus -infected human livers, occludin and ADRP mRNA expression levels correlated with each other. Hepatitis C virus increases occludin expression via the upregulation of ADRP.PMID:26731658
Data show that claudin-6 (CLDN6) R209Q and occludin (OCLN) P24A mutations do not affect HCV pseudoparticles (HCVpp) entry.PMID:26561856
resistance to HCV in HIV+ patients may be related to genetic variation in SCARB1 or OCLNPMID:26571379
Angiopoietin-1 Regulates Brain Endothelial Permeability through PTPN-2 Mediated Tyrosine Dephosphorylation of OccludinPMID:26090670
TIMP1 downregulates MMP-2 activity and inhibits the degradation of occluding in Caco-2 intestinal cellsPMID:25665057
Study uncovers a novel antiviral effect of miR-122 on human liver cells and shows that over-expression of miR-122 can decrease HCV entry into hepatocytes through down-regulation of OCLN.PMID:25302477
Lipid raft-associated processes, such as PP2A and MMP-2 activation, participate in PCB153-induced disruption of occludin function in brain endothelial barrier.PMID:26080028
miR-18a and RUNX1 could reversely regulate the permeability of blood-tumor barrier as well as the expressions and distributions of ZO-1, occludin and claudin-5.PMID:25452107
Zonula occludens-1, occludin and E-cadherin expression and organization in salivary glandsPMID:25248927
LL-37 selectively increased the expression of several claudins and occludin, and enhanced their membrane distribution.PMID:24862212
In conclusion, our present study indicated that miR-34c regulated the permeability of BTB via MAZ-mediated expression changes of ZO-1, occludin, and claudin-5.PMID:25201524
findings suggest that cerebral vascular cells express functional BACE1. Moreover, elevated vascular BACE1 may contribute to deficiency of occludin in caa.PMID:24739782
luciferase assays and chromatin immunoprecipitation assays showed that KLF4 up-regulated the promoter activities and interacted with "CACCC" DNA sequence presented in the promoters of ZO-1, occludin, and claudin-5.PMID:24318462
We conclude that OCEL-mediated occludin interactions are essential for limiting paracellular macromolecular flux.PMID:23924897
Data suggest components of diet supplements (here, glutamine/arginine) can improve permeability and tight junction protein expression (OCLN/zona occludens 1) in enterocytes exposed to deleterious effects of antineoplastic agents (here, methotrexate).PMID:23428392
Eosinophilic esophagitis (EoE), an inflammatory atopic disease of the esophagus, causes massive eosinophil infiltration, basal cell hyperplasia, and sub-epithelial fibrosis. Western analysis of pinch biopsies from EoE and normal pediatric patients indicated reduced expression of intercellular junction proteins, E-cadherin and claudin-1 and increased expression of occludin and vimentin.PMID:23792687
actin cytoskeletal dynamics is detrimental to METH-induced BBB dysfunction by increasing internalization of occludin.PMID:24081143
identification of a novel deletion/rearrangement of OCLN that results in band-like brain calcification, limited cognitive abilities, failure to thrive and renal dysfunction in early childhoodPMID:23793442
In HepG2 cells, both hepatitis C virus cell entry and tight junction formation were impaired by OCLN silencing and restored by expression of antibody regulatable OCLN mutant.PMID:23555257
Loss of occludin is involved in adhesion, apoptosis, differentiation, Ca2+-homeostasis and neoplastic transformation in UV-exposed human keratinocytes and in skin neoplasms.PMID:23390516
Sinonasal epithelium in allergic fungal rhinosinusitis displays increased epithelial permeability and an altered expression of occludin.PMID:22927233
HuR promotes occludin translation by blocking occludin mRNA translocation to P-bodies via the displacement of CUGBP1.PMID:23155001
It is concluded that attenuated expression of the TJ proteins occludin and ZO-1 in human gastric epithelial cells could be involved in clopidogrel-induced gastric mucosal injury through activation of the p38 MAPK pathwayPMID:23220562
Elevated occludin expression is associated with active ulcerative colitis.PMID:22134947