MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC KTSETVPRPA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
G-protein coupled opioid receptor that functions as receptor for the endogenous neuropeptide nociceptin. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling via G proteins mediates inhibition of adenylate cyclase activity and calcium channel activity. Arrestins modulate signaling via G proteins and mediate the activation of alternative signaling pathways that lead to the activation of MAP kinases. Plays a role in modulating nociception and the perception of pain. Plays a role in the regulation of locomotor activity by the neuropeptide nociceptin.
Gene References into Functions
The rs2229205 SNP in the OPRL1 gene may be a genetic factor that contributes to individual differences in the vulnerability to smoking in Japanese individualsPMID:27490265
The results of in vitro Ala scanning analyses revealed that the labeled residues were Cys59 in TM1, Cys215 and Cys231 in TM5, and Cys310 in TM7. The present study has provided a novel method of Cys(Npys)-affinity labeling for identification of the ligand-binding sites in the ORL1 receptor.PMID:27271345
Study presents evidence suggesting that the PNOC and OPRL1 are dysregulated in suicide completers, thereby potentially contributing to impaired emotional and behavioral control and, ultimately, to the suicidal crisisPMID:26349406
Data suggest that nociceptin and nociceptin receptor evolved as one of 4 opioid receptor systems in vertebrates; this system exhibits both analgesic and hyperalgesic effects. [REVIEW]PMID:25677768
Opioid neuropeptide systems are important mediators of ovarian steroid signaling that regulate reproduction in female; data suggest that nociceptin and nociceptin receptor system in arcuate nucleus of hypothalamus is such a system. [REVIEW]PMID:25677773
Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of the immune response and in pathogenesis of autoimmune diseases. [REVIEW]PMID:25677775
Data suggest that the nociceptin/nociceptin receptor system is involved in modulation of psychological and inflammatory stress responses and in pathogenesis of anxiety. [REVIEW]PMID:25677776
Data suggest that interaction between the nociceptin/nociceptin receptor system and the orexin/orexin receptor system in neurons of the hypothalamus positively and negatively modulate complex and integrated responses to stress. [REVIEW]PMID:25677777
Data suggest that nociceptin/nociceptin receptor signaling in neurons of the hippocampus modulate learning and memory. [REVIEW]PMID:25677778
Overall methylation levels in the promoter regions of three genes (ALDH1A1, OPRL1 and RGS19) are elevated in subjects who were exposed to childhood adversity.PMID:23799031
Oprl1 is associated with amygdala function, fear processing, and posttraumatic stress disorder symptoms.PMID:23740899
Dominant-positive Arrestin3 but not Arrestin2 was sufficient to rescue NOPR-S363A internalization and JNK signaling.PMID:23086955
Decreased plasma nociceptin/orphanin FQ is closely associated with the presence of acute cardiovascular disease, and the severity of symptoms has a significant negative correlation with the N/OFQ levels.PMID:22849833
crystal structure of human NOP (also known as ORL-1), solved in complex with the peptide mimetic antagonist compound-24PMID:22596163
Our studies reported here show that ORL1 exhibits the ability to cross-desensitize CXCR4 in both primary leukocytes and hematopoetic cell linesPMID:21656184
The presence of at least one C allele is associated with a decreased expression of OLR1 mRNA in the absence of hsa-miR369-3p de-regulationPMID:21709374
OPRL1 expression was 1.83 times higher in vitiligo involved skin when compared to healthy control skin.PMID:20888736
study provides evidence for an association of two variants of the OPRL1 gene, rs6090041 and rs6090043, with vulnerability to develop opiate addiction, suggesting a role for nociceptin/orphanin FQ receptor in the development of opiate addictionPMID:20032820
Our results support the concept postulating that chronic ethanol consumption and withdrawal downregulate the PNOC/OPRL1 system, which critically controls alcohol intake.PMID:19501074
Data show that the dynamic cycle between nociceptin receptor activation, internalization and recycling determines the activity of this receptor on the cell surface.PMID:12568343
Nociceptin receptor mRNA is expressed in human trigeminal ganglia but not in basilar arteries.PMID:12576178
OP4/ORL1 receptor is synthesized and functionally expressed in vascular endothelial cells, presumably as a starting point for some vasoactive mechanism(s).PMID:14660000
Nociceptin-induced receptor endocytosis mainly occurred via clathrin-coated pits. Mainly internalized through the endosome compartment. Receptor phosphorylation necessary for internalization.PMID:15016723
Results suggest that opioid receptor-like (ORL1) receptor utilizes both G(oA) and G(oB) for signal transduction.PMID:16800795
The ORL-1 receptor is expressed by all subtypes of leukocytes; its function is not the modulation of cytokine production and requires further studies.PMID:16807742
Polymorphism not associated with panic disorder.PMID:17167337
molecular analysis of the nociceptin receptor and its ligand complexesPMID:17456499
We analyzed 10 single nucleotide polymorphisms (SNPs) in OPRL1 and 15 SNPs in PNOC in a sample of 1923 European Americans from 219 multiplex alcohol dependent familiesPMID:17910740
However, there was evidence in support of LD between the OLR1+1071, the OLR1+1073, and the rs669 SNPs, with T-C-A haplotype being associated with significant increased risk of AD.PMID:18191876
Human CD14(+) monocytes expresses the mRNA for ORL1. The ORL1/nociceptin system plays a role in regulating chemotactic responses of leukocytes through chemokine suppression.PMID:18247127
We genotyped 15 single nucleotide polymorphisms (SNPs) spanning the OPRL1 locus and found that SNP rs6010718 was significantly associated with both Type I and Type II alcoholics.PMID:18269382
existence of a cross-talk between NOP and kainate receptors, leading to an interplay between glutamate and N/OFQ circuitsPMID:18286384
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle. Note=Ligand binding leads to receptor internalization into cytoplasmic vesicles, decreasing the amount of available receptor at the cell surface. Internalization requires phosphorylation at Ser-363. Can recycle to the cell membrane.