NPY1R; NPYR; NPYY1; Neuropeptide Y receptor type 1; NPY1-R
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-384
Target Protein Sequence
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is NPY > [Pro-34] PYY, PYY and [Leu-31, Pro-34] NPY > NPY (2-36) > [Ile-31, Gln-34] PP and PYY (3-36) > PP > NPY free acid.
Gene References into Functions
the current review aims to compile, evaluate and summarise current knowledge on PYY, with particular emphasis on obesity and diabetes treatment, and the importance of specific Y receptor interactions for this.PMID:29412828
crystal structures of the human Y1R bound to the two selective antagonists UR-MK299 and BMS-193885 at 2.7 and 3.0 A resolution, respectivelyPMID:29670288
NPY1R plays an inhibitory role in tumor growth and may be a promising therapeutic target for Hepatocellular carcinomaPMID:27262566
expressed in to B and T lymphocytes and mast cells in infantile hemangiomasPMID:27889920
MAPK activation by NPY Y1 receptors is an internalization-independent pathway and that this receptor can transactivate the IGFR receptor.PMID:25817573
Report design of argininamide-type NPY1R antagonists.PMID:25884646
Y1R expression in visceral adipose tissue might be an indicator of increased risk of metabolic syndrome.PMID:23838112
The influence of beta-arrestin adaptors and endocytosis mechanisms on plasma membrane diffusion and particle brightness of GFP-tagged neuropeptide Y (NPY) receptors, was investigated.PMID:22487268
Npy1 receptor transgene overexpression is associated with modest anxiolytic-like effect on mice in the open field and elevated plus maze tests.PMID:21971867
For the first time we report a significant association between nicotine dependence and DRD5, NPY1R MAP3K4 single nucleotide polymorphism.PMID:22309839
neuropeptide Y1 and Y2 receptors were expressed in 33 percent of testicular tumors and Y1 on intratumoral blood vessels in 50 percent of testicular tumorsPMID:21295110
The increased expression of NPY Y1 receptor may be related to local blood flow reduction and structural changes of pelvic supporting tissue in patients with pelvic organ prolapse.PMID:18953866
A C-terminal tyrosine-based motif is critical for the constitutive internalization of Y(1) receptors lacking the last 32 C-terminal amino acids.PMID:20837140
results suggest that the receptor-ligand interactions have changed during evolution after Y1 and Y2 arose from a common ancestral receptorPMID:20471432
NPY1R and NPY5R have roles in nutrient-specific food intake in EuropeansPMID:19759915
the NPY Y(1) receptor induces the expression of CRE containing target genes through the CaM kinase-CREB pathwayPMID:11814622
Peptide YY and neuropeptide Y exert their effects through the NPY1 receptors in human colon mucosa.PMID:11906964
human NPY Y1 and NPY Y2 receptors were detected in cerebral, meningeal, and coronary arteries using reverse transcriptase-polymerase chain reaction (RT-PCR); in addition, the trigeminal and superior cervical ganglia were positive for both receptorsPMID:12084524
Expression of Y1 receptors characterize reactive and proliferating glial cells of diseased retina and may be involved in proliferation of injured glial cells causing regrowth of vitreoretinopathy membranes and consequent secondary retinal detachments.PMID:12203398
High expression of neuropeptide Y receptor Y1 is associated with tumors of the human adrenal gland and extra-adrenal paragangliaPMID:15623622
Neuropeptide-Y induced endothelial cell migration was mimicked by agonists and fully blocked by antagonists for any specific NPY receptor (NPY1R).PMID:16891622
data suggest that the K374T variant is a rare, nonfunctional polymorphism of the NPY-Y1R gene and that mutations of the highly conserved NPY-Y1R gene do not represent a frequent mechanism underlying human idiopathic central pubertal disorders.PMID:17140570
Ewing sarcoma family of tumors expressed the NPY receptor subtype Y1 on tumor cells in remarkably high incidencePMID:18698022
ICL3 stabilizes the Y1 receptor in the inactive state and confers structural properties critical for regulating Y receptor activation and signal transductionPMID:18812316
Results suggest that rabbit and human Y1, Y2 and Y5 receptor subtypes are well conserved, whereas Y4 receptors are less well conserved.PMID:19481128
the studied LEP, NPY1R and GPR54 variants do not have a major influence upon pubertal timing in Caucasian women.PMID:19506390
novel pathophysiological links between the NPY1R locus, autonomic activity, and blood pressurePMID:19712806