MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQLITLWVLF VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTDINWRFTGDFTAPDLV CRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIVIAWSLSFLFSIP TLIIFGKRTLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISIMYGIVIRTIWIK SKTYETVISNCSDGKLCSSYNRGLISKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFN LLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERH EMQILSKPEFI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
G-protein coupled receptor for neuropeptide S (NPS). Promotes mobilization of intracellular Ca(2+) stores. Inhibits cell growth in response to NPS binding. Involved in pathogenesis of asthma and other IgE-mediated diseases.
Gene References into Functions
A decreased risk of psychological stress was only found in TT of NPSR1 (rs324981): A allele carriers vs. TT genotype (OR 1.64, 95% CI 1.11, 2.42), and AT genotype vs. TT genotype (OR 1.76, 95% CI 1.17, 2.65). We found that the NPSR1 (rs324981) T/T genotype decreased the risk of psychological stress, while the overall coping style was a risk factor for psychological stress.PMID:30242809
Results show higher fronto-limbic connectivity in adolescent A allele carriers vs. children carrying the A allele, a pattern which could not be discerned in TT homozygotes. Adolescent NPSR1 TT risk genotype carriers vs. adolescent A allele carriers displayed a reduced fronto-amygdala and fronto-insula effective connectivity suggesting basis of risk-increasing effect of the NPSR1T allele for anxiety.PMID:26503268
Sequence variation in NPSR1 may contribute to sex differences in stress regulation.PMID:27883964
we have utilized a broad-scaled affinity proteomics approach to identify three proteins (CCL5, HPGDS, and NPSR1) with altered plasma levels in asthmatic children compared to healthy controls, representing the first evaluation of HPGDS and NPSR1 in plasma.PMID:27145233
The interaction between 5-HTT (LL) and BDNF (A+) increased the risk of anxiety, and the interaction between BDNF (A+, GG) and NPSR1 (AA, T+) increased the risk of depression in asthmatic patients.PMID:27176146
findings demonstrate that hNPS-(1-10) is a biased agonist favoring Galphaq-dependent signaling. It may represent a valuable chemical probe for further investigation of the therapeutic potential of human NPS receptor-directed signalingin vivo.PMID:26865629
anxiety sensitivity correlated negatively with prefrontal activity in NPSR1 rs324981 carriers possibly suggesting a decompensation of the adaptive compensatory upregulationPMID:25971599
Results suggest the functional NPSR1 gene A/T variant to influence glutamate+glutamine concentrations in the bilateral anterior cingulate cortex in healthy male subjects during CCK-4 induced panicPMID:26235955
The T-allele of the NPSR1 rs324981 polymorphism is associated with increased impulsivity and ADHD-related traits in non-clinical cohorts.PMID:25744621
The results suggest neuropeptide S receptor gene variation to be associated with alterations of prefrontal functioning in the attentional functions alerting and executive control partly modulated by anxiety sensitivity.PMID:25842293
Results show that NPSR1 polymorphism is associated with AUD and alcohol consumption, dependent on sex, environment and age.PMID:24754478
gene polymorphism is a risk factor for high IgE-associated atopic eczema at the age of two years in Finland if there is no probiotic treatmentPMID:24439655
The functional SNP rs324981 located in the gene of NPSR1 was significantly associated with objectively obtained sleep parameters in a sample of elderly white subjectsPMID:24896296
results suggest a potential protective function of the NPSR1 rs324981 A/A genotype against pathologically enhanced anxiety that might be explained by stronger reflective prefrontal regulation over the subcortical fear response.PMID:23103692
Genetic variation at the NPSR1 locus impacts children's predisposition to ecurrent abdominal pain episodes in a Swedish population.PMID:25091462
study provides first evidence for the assumption that a NPSR1 variant modulates brain activation under stress, interacting with the environmental risk factor urban upbringingPMID:24800784
In the Estonian population, NPSR1 A/T polymorphism together with environmental factors is associated with anxious, depressive and activity-related traits, increased prevalence of affective/anxiety disorders and a higher likelihood of suicidal behaviour.PMID:24331455
NPSR1 A/T polymorphism is associated with impulsivity, ADHD symptoms and personality, mirroring the activity- and anxiety-mediating role of NPSR1.PMID:23325374
Neuropeptide S receptor 1 (NPSR1) activates cancer-related pathways and is widely expressed in neuroendocrine tumors.PMID:24915894
Differential gene-environment effects of the NPSR rs324981 T allele indicate recent life events with respect to anxiety sensitivity.PMID:22404660
NPS receptor may have a pathological role in individuals with severe asthma and/or elevated serum IgE levels.PMID:24239856
The present data demonstrated that QA1 and PI1 act as potent NPSR antagonists in vitro, however their usefulness for in vivo investigations in mice seems limited probably by pharmacokinetic reasons.PMID:23911665
Relate NPSR1 genotype to early onset obsessive-compulsive disorder.PMID:23680103
The results of this study showed involvement of the NPS system in the regulation of the neuroendocrine stress response in humans.PMID:23466585
RORA SNPs are associated with childhood asthma and show epistasis with NPSR1, and the interaction between RORA and NPSR1 may be of biological relevance.PMID:23565190
In summary, the more active NPSR1 T allele may confer enhanced response inhibition and increased error monitoring and might drive particularly error monitoring as a neurophysiological endophenotype of anxietyPMID:23319044
NPS is able to stimulate human monocyte chemotaxis and that this effect is entirely due to selective NPSR activation.PMID:23142110
DNA methylation levels in the promoter of NPSR1 showed small but significant associations with asthma and to related traits such as allergy and certain environmental exposures.PMID:23372674
we consider NPSR as a promising target for antipsychotic drug developmentPMID:22078257
analysis of molecular evolution of the neuropeptide S receptor and cross-species comparisonPMID:22479518
NPSR1 gene is associated with reduced risk of rheumatoid arthritis.PMID:22548958
findings represent a first step to decipher NPSR1 locus complexity and its impact on several human conditions NPS antagonists have been recently described, and our results are of potential pharmacogenetic relevancePMID:22216302
Ther neuropeptide S receptor genotype is associated with increased amygdala responsiveness to fear-relevant stimuli.PMID:21525857
results provide converging evidence for a female-dominant role of NPSR gene variation in panic disorder through heightened autonomic arousal and distorted processing of anxiety-relevant emotional stimuli.PMID:20603625
There is an NPSR1 isoform-specific link to pathogenetic processes in asthma and allergy.PMID:21707994
data suggest a genetic and neuroanatomical substrate for catastrophizing overinterpretations of fear reactions.PMID:20628342
The available information regarding NPS and its receptor and the biological actions modulated by the NPS-NPSR system, is summarized.PMID:19824051
NPS-NPSR1 signaling is likely involved in anxietyPMID:20705147
Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)PMID:20701904
Data show that NPSR1 polymorphism may be relevant to RA susceptibility and its clinical manifestation.PMID:20179762
Observational study of gene-disease association. (HuGE Navigator)PMID:19913121
Observational study of gene-disease association. (HuGE Navigator)PMID:20603625
Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)PMID:20628086
Observational study of gene-disease association. (HuGE Navigator)PMID:20628342
Observational study of gene-disease association. (HuGE Navigator)PMID:20705147
Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)PMID:20379614
Observational study of gene-disease association. (HuGE Navigator)PMID:20503287
Results suggest that N-linked glycosylation is not important for neuropeptide S receptor biogenesis or function, and that residue D105 might be critical for receptor binding.PMID:19874863
Observational study of gene-disease association. (HuGE Navigator)PMID:20179762
Expression of several neuropeptides is induced upon NPS-NPSR1 signaling; NPSR1 variants are associated with colonic transit in functional gastrointestinal diseasesPMID:19732772
Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle ce