Home
Product
Protein
Transmembrane Proteins
Recombinant Human Neuropeptide FF receptor 2 (NPFFR2)

Recombinant Human Neuropeptide FF receptor 2 (NPFFR2)

Code: CSB-CF015983HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6400

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

NPFFR2

Uniprot NO.

Q9Y5X5

Alternative Names

NPFFR2; GPR74; NPFF2; NPGPR; Neuropeptide FF receptor 2; G-protein coupled receptor 74; G-protein coupled receptor HLWAR77; Neuropeptide G-protein coupled receptor

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-522

Target Protein Sequence

MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRR LGLSRQTAKSSWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWN VNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHT VTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVA IAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQN KTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHTGRKN QEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQ LVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETTNSSEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for NPAF (A-18-F-amide) and NPFF (F-8-F-amide) neuropeptides, also known as morphine-modulating peptides. Can also be activated by a variety of naturally occurring or synthetic FMRF-amide like ligands. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103. PMID:26211894
The NPFF2 neuropeptide FF receptor phosphorylation sites have been mapped and their role identified in receptor regulation. PMID:25326382
These data show that NPFF-induced heterologous desensitization of MOP receptor signaling is mediated by GRK2 and could involve transphosphorylation within the heteromeric receptor complex. PMID:22375000
Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO. PMID:21818152
Besides regulation of reproduction, kisspeptins have a potential to mediate physiological effects on autonomic regulation and nociception in humans via the NPFF2R pathways. PMID:20600636
species-related differences in the binding properties of NPFF(2) receptors PMID:19944730
Evidence does not support the hypothesis that NPGPR is involved in feeding regulation. PMID:12609745
The BIBP3226 and PFR(Tic)amide, on Human neuropeptide FF receptor subtype 2 (hNPFF2) were investigated. PMID:15127947
neuropeptide FF analogs show that NPFF2 receptors couple to the four subunits assayed. PMID:15608144
expression of hNPFF2 receptor mRNA was up-regulated by neuropeptide FF PMID:16336216
NPFF system may also have species-specific features since the NPFF2 receptor mRNA expression differs from that reported for rat PMID:17157836
findings suggest that a common haplotype in the GPR74 gene protects against obesity, which, in part, is caused by a relief of inhibition of lipid mobilization from adipose tissue PMID:17503329
we identified hFF2 positive neurons in the forebrain and medulla oblongata of individuals who died suddenly. PMID:18565622

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Isoform 1 is abundant in placenta. Relatively highly expressed in thymus, testis, and small intestine. Expressed at low levels in several tissues including spleen, prostate, brain, heart, ovary, colon, kidney, lung, liver and pancreas and not expressed in

Database Links

HGNC: 4525

UNIGENE: Hs.99231

KEGG: hsa:10886

STRING: 9606.ENSP00000307822

OMIM: 607449

Promotions